spacer

EBI Dbfetch

ID   AK004991; SV 1; linear; mRNA; HTC; MUS; 3039 BP.
XX
AC   AK004991;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male liver cDNA, RIKEN full-length enriched library,
DE   clone:1300013H05 product:ANTIQUITIN 1 homolog [Homo sapiens], full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3039
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 404a1527b7a9ba6bc2b85c591687de42.
DR   Ensembl-Gn; ENSMUSG00000053644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174518; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1300013H05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3039
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1300013H05"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             287..1822
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="ANTIQUITIN 1 homolog [Homo sapiens] (SPTR|Q9BUL4,
FT                   evidence: FASTY, 89%ID, 100%length, match=1533)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9DBF1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="MGI:MGI:108186"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DBF1"
FT                   /protein_id="BAB23726.1"
FT                   /translation="MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPAN
FT                   NEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLV
FT                   SLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGII
FT                   TAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSL
FT                   VCGGADIGTTMARDERVNLLSFTGSTQVGKEVALMVQERFGKSLLELGGNNAIIAFEDA
FT                   DLSLVVPSVLFAAVGTAGQRCTTVRRLFLHESIHNEVVDRLRSAYSQIRVGNPWDPNIL
FT                   YGPLHTKQAVSMFVRAVEEAKKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHDAPIVHQE
FT                   TFAPILYVFKFQDEEEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIP
FT                   TSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ"
XX
SQ   Sequence 3039 BP; 755 A; 715 C; 846 G; 723 T; 0 other;
     ggggcagccc agcggtttcc ccaaggaagg tcccagccca gatccaagga acgagcatgc        60
     ccagaatacc tgagctctga gcgtagtgcg gcccagcagc gtgcgtcggt ttgaaagctc       120
     ggctccaacc cagcggactt cagaagcagc gggtggcgca gttccccgcc ccctcagcct       180
     tgtccccgcc ccagaccctg aggcagcaac tttacccaga gggctctgtg tgcagtctgt       240
     gaagaccagc aagctttccg gaccttggag caggcccgcc gcccacatgt ctactctgct       300
     gatccatcat ccccagtatg cctggctgca agacctgggg ctccgcgagg ataacgaggg       360
     cgtgtataat ggaagctggg gcggccgggg agaggtaatt acgacctatt gtcctgctaa       420
     caatgagcca atagcaagag tccgacaggc cagcctgaag gactatgaag aaaccatcgg       480
     gaaagccaag aaagcctgga acatctgggc agatattcct gccccaaaac gcggagaaat       540
     agtcagaaag attggcgatg ccttccggga gaagatccaa ctactgggaa gactggtgtc       600
     tttggagatg gggaaaatcc tggtggaagg aataggcgag gttcaggagt acgtggacgt       660
     ctgcgattat gctgctggct tgtcgaggat gatcggggga cccaccttgc cttctgaaag       720
     acccggccat gctctcatcg aaatgtggaa tcccttaggc ttggtgggaa tcatcactgc       780
     cttcaatttc cccgtggctg tgtttggctg gaacaatgcc atagctctga tcacagggaa       840
     tgtctgcctt tggaaaggag caccgactac gtccctcgtt agtgtggctg tcacaaagat       900
     catagcccag gttttggagg acaacctgct gcccggtgcc atttgttccc tggtttgtgg       960
     tggagcagat atcggcacaa cgatggccag agatgagcgt gtgaacctgc tgtccttcac      1020
     tgggagcact caggtgggga aggaggtggc cctcatggtg caggagaggt ttgggaaaag      1080
     cttgttggag cttggaggaa acaatgccat tattgctttc gaggacgcgg acctcagctt      1140
     ggttgttccg tcagttctgt ttgccgccgt gggaacagct gggcaaaggt gtaccactgt      1200
     gaggagactg tttttgcacg aaagcatcca taatgaagtt gtggacagac tgagaagtgc      1260
     ctactcacag atccgtgttg ggaacccctg ggaccccaat atcctctatg gaccgctcca      1320
     taccaaacag gcagtgagca tgtttgtgag agccgtggaa gaagccaaga aacaaggggg      1380
     cacagtggtc tatgggggca aggtcatgga ccaccctggc aattacgtgg aacccaccat      1440
     tgtgaccggt cttgcccatg atgcgcccat tgttcaccag gagacttttg ccccaatcct      1500
     ctatgtcttc aaattccagg atgaagaaga ggtctttgaa tggaacaatg aagtaaaaca      1560
     gggactttca agtagtatct ttaccaaaga tttgggcaga atcttccgct ggcttggacc      1620
     taaaggttcc gactgtggca tcgtgaacgt caatattcct accagcgggg ctgagattgg      1680
     tggtgcgttt ggcggagaga agcacactgg cggtggccgg gagtctggca gcgacgcctg      1740
     gaagcagtac atgaggagat ccacatgtac catcaactac agcacgtccc tccctctggc      1800
     tcagggaatc aagtttcagt gatactgcgt gggcttggcg tcccttagcc attcctgtgg      1860
     ctgctcggaa gaagcctgaa aggaccctga cttgccccgg ataaatgatg gctttgagta      1920
     cggacagcag tgtctaatct ccagtgattc ccagacccct gtctaaatca agatactcat      1980
     ttatcaaaag ttcaaaatta aatattcaca acctagctgc atttagcaaa agataggttt      2040
     ggtgagtttt tatgttacta attacttttt ttattacagc taatcatttc ttagtgaagt      2100
     acatgccatc ataggaggtt ggggccatgg aaaatgcaat aggaaggaag aagtctttgc      2160
     agtggagaaa tgtcttctaa gcagtgctga atcctcatgg tcccgtcctg gcaggggttg      2220
     aaggggagag gtacccccac atgctgggga cctcagcaca gtttcatgtg catgatttgc      2280
     agtgctccaa atgacaatgg gccatttttg ggtgaggtga ggaacttaac actgttgtga      2340
     atggttgctg ggatgtgtca acccctgggt tcaaatctca gtaccaccac aacaaagata      2400
     atgctctaaa aataatgctc acccagttaa gactgctcct gactgtgtca gccagaaaga      2460
     aatgtgcagg ggtagacaga ccttcgttct tgttccaaac cttgctggga acttagggac      2520
     tgaagttgct cgtgaaagca catctggatg cccgagtcac ctcaggcttc tgcagctgct      2580
     catgggtttc tcctctggga aggtcactgc tgagaggcta aggtctcact gggaagctgt      2640
     gctgggccca gcggtccctg ctctcctgtg gtgccgttgc tctgtacttc tgtgtagcag      2700
     tcaccactgg gcctgctcct gccacatcgg gctcctggag aaacccttag ggaataggac      2760
     attgtaggcc tcatgagtcg tcatggtgtg gaaagatttg gacaatagta agaaatctgg      2820
     gggactgaca gtgtggggaa gaagcagggg ggacactaat actaacatat taaataatat      2880
     ggtgatatac ctttatataa ttaaatttgt agtagatttg actataaaaa ttaaaggggc      2940
     tgtgaatata gcttggttag gtaggctgct tgccactcaa tgcctgggat tccatctcca      3000
     gcactgcact aaattcatat aaatacatgc atttaagtc                             3039
//


spacer
spacer