spacer

EBI Dbfetch

ID   AK004782; SV 2; linear; mRNA; HTC; MUS; 2652 BP.
XX
AC   AK004782;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male lung cDNA, RIKEN full-length enriched library,
DE   clone:1200015E08 product:lectin, galactose binding, soluble 8, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2652
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c49a12650b326abaffb3f7d19af70bf6.
DR   Ensembl-Gn; ENSMUSG00000057554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124888; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1200015E08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2652
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1200015E08"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             282..1232
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="lectin, galactose binding, soluble 8
FT                   (MGD|MGI:1928481)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542M5"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/TrEMBL:Q542M5"
FT                   /protein_id="BAB23560.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
FT   polyA_signal    2637..2642
FT                   /note="putative"
FT   polyA_site      2652
FT                   /note="putative"
XX
SQ   Sequence 2652 BP; 759 A; 575 C; 613 G; 705 T; 0 other;
     gctggcgact gcgggctcag ggacatcggg ataccactgt tcccggaccg gaatccgagt        60
     gtggacacgg catcccgccg tctcctccgt gacacatgca cggggcaccg gacaccggga       120
     gcgatcgtgg gttgaggctt gtactgggac cgtagtgtcg ggacaacgct gactgctgcg       180
     gacaagtttt tactttgagt aatccttaaa tgaagagtgg gtaaagtgtg tatacggaag       240
     agagactcca atcaacaata tcaataagtt gaaaaagaaa aatgttgtcc ttaaataacc       300
     tacaaaatat catctataac ccgataatcc cctatgttgg caccattact gagcaattga       360
     agcctggctc tctgattgta atccgtgggc atgtccctaa agattcagaa agattccagg       420
     ttgactttca gctgggcaac agcctgaagc caagagcaga cgtggccttc cactttaacc       480
     ctcggttcaa aaggtctagc tgcattgttt gtaacacact gacacaggag aagtggggct       540
     gggaggagat cacctacgac atgcccttca gaaaagaaaa gtcctttgag atcgtgttca       600
     tggtgctcaa gaacaaattc caggtggctg tgaacggaag gcatgttctg ctgtacgccc       660
     acaggatcag cccggagcag atcgacacag tgggcatcta cggcaaagtg aacatccact       720
     ccatcgggtt cagattcagc tcggatttac agagtatgga aacatctgct ctgggactga       780
     cacagataaa cagagagaat atacaaaagc caggcaagct ccagctgagc ctgccatttg       840
     aagcaaggtt gaatgcctcc atgggtcctg gacgaaccgt tgtcattaaa ggggaagtga       900
     acaccaatgc ccgaagcttt aatgttgacc tagtggcagg aaaaacaagg gatatcgctc       960
     tgcacttgaa cccacgcctc aatgtgaaag catttgtaag aaattccttt cttcaggatg      1020
     cctggggaga agaggagaga aatattacct gcttcccatt tagttctggg atgtactttg      1080
     agatgataat ctactgtgat gtccgggaat tcaaggttgc tataaatggt gtgcacagcc      1140
     tggagtacaa acacagattt aaagacctaa gcagtattga tacactatca gtcgatggtg      1200
     atatccgttt gctggatgta aggagctggt agctaccatg actgccaaaa cccccgaaat      1260
     acaaaatggc ttatccggta ctggccatgt caaatgcatc tcgctttcac catattgttt      1320
     atattgctaa gttgagctcc tccaacatca agtcctactg gtgttgtcag gtctggccat      1380
     gcagtacatt cagaggaaca gagccggggc aatcacagct cactgccaga gaggctctgc      1440
     acactgggtc cctcttataa accacactca gcaaatattt aagtgcctaa tatactacat      1500
     atactagcta atagggatgg caagcatact tcctttgtat attctctgag ccgggcacag      1560
     acatggcagg gcccagaact tgtgtggtcc atgttttcta gcacttcgta ccagtttctg      1620
     gcctcctaat gtagggtctt cttgctggca ttgcattaac cccactaggg gcctttgcag      1680
     ttaaggtcag aaaaatatac taatggatgg caaacactac ttccccagca acccttttca      1740
     taatcagcat tctatcatat ctcataattg aagactgcat agcatttact tagctctcac      1800
     cgctttaaac tttataaaat gtatgatgct gaacacagca gaaaaactga ggccaaaacc      1860
     ctgaattatg acaaaacaag tgttctgctc caagcagatt tctgctggtt gattggcgct      1920
     caagtccagg gtgtgtgggt acctgtggca aagtaaggca gaagttggat aaaccgtgtg      1980
     tgtaaaaccc tcttggacgt atatataaaa caagcactat caaagcaaac ccaggggcgt      2040
     agtgtgaaag gcttagttgg tgtggagact agccctcgtg cctttgggtc tgaagatgtc      2100
     ggtctgcagc agcagcgagg tcaggcacat taaaccacag gacagaattc tgctggggtt      2160
     taggagtatt cagccaatct gcttagatat atgcacttgt gcatatgaaa taataccatc      2220
     agcagtctta ctcaaggcag caactgctag tccttcattt tcatgcaaat ttattatgtt      2280
     cactcttcaa tatggggtgg tgggtggaac tgggtaattt gtacggaggc caggaggctc      2340
     tagaattctc cagagttatg tcttcataaa gaatgagtct tcataaagaa tgcactactg      2400
     agatattggg ggctcaaagg cactcaggaa aaaaaaataa aagcctattc atacaacagc      2460
     ttattttcat ttctattttt acacaattaa gactgattct aagtagattc agtcttaagt      2520
     tcttagattt ttttttttaa aaagctgctg gaatttaggt tgtgagacct tctgttgtat      2580
     attccgaaat tctatctcta aactgcaaaa tgcctttttg cttgtcctaa ttctgcatta      2640
     aagttttata tt                                                          2652
//


spacer
spacer