Dbfetch

ID   AK004772; SV 1; linear; mRNA; HTC; MUS; 2808 BP.
XX
AC   AK004772;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus adult male lung cDNA, RIKEN full-length enriched library,
DE   clone:1200014O08 product:phosphodiesterase 1B, Ca2+-calmodulin dependent,
DE   63 kDa, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2808
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ecdf24e2f3192c37f10aa073c52857ee.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1200014O08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2808
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1200014O08"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             63..1550
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="phosphodiesterase 1B, Ca2+-calmodulin dependent, 63
FT                   kDa (MGD|MGI:97523)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9DBS6"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013706"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="MGI:MGI:97523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DBS6"
FT                   /protein_id="BAB23551.1"
FT                   /translation="MVKQLENGEVNIEELKKNLEYTASLLEAVYIDETRQILDTEDELR
FT                   ELRSDAVPSEVRDWLASTFTQQTRAKGRRAEEKPKFRSIVHAVQAGIFVERMFRRTYTS
FT                   VGPTYSTAVHNCLKNLDLWCFDVFSLNRAADDHALRTIVFELLTRHSLISRFKIPTVFL
FT                   MSFLEALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIEVLAIIFAAAIH
FT                   DYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVFRMMQDDEMNIFINLTKDEFAE
FT                   LRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKSKALSLLLHAADISHPTKQWSVH
FT                   SRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVA
FT                   EKSVQPLADDDSKPKSQPSFQWRQPSLDVDVGDPNPDVVSFRATWTKYIQENKQKWKER
FT                   AASGITNQMSIDELSPCEEEAPSSPAEDEHNQNGNLD"
FT   regulatory      2789..2794
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2808
FT                   /note="putative"
XX
SQ   Sequence 2808 BP; 638 A; 785 C; 735 G; 650 T; 0 other;
     gggcaaaccc tgttcctgtc cagaggagcc acctccaggg ccccatcctc aggctgcgct        60
     acatggtgaa gcagttggag aatggggagg ttaacatcga ggagctgaag aaaaacctgg       120
     aatacacagc ttccctgctg gaagctgtct acattgatga gacaaggcaa atcctagaca       180
     ctgaagatga gcttcgggaa cttcggtcag atgctgtgcc ttcagaggtg cgggactggt       240
     tggcctccac cttcacccag cagacccgag ccaaaggtcg cagggcagaa gagaaaccca       300
     agttccgaag catcgtgcat gctgtgcagg ctgggatctt cgtggagcgg atgttccgga       360
     gaacgtatac ctctgtgggc cccacatact ctactgcagt ccacaactgt ctcaagaacc       420
     tggacctctg gtgctttgat gtcttttcct tgaaccgggc agccgatgac cacgctctga       480
     ggaccattgt ttttgagttg ctgactcggc atagcctcat cagccgcttt aagattccca       540
     cagtgtttct gatgagtttt ctggaggcct tggagacagg ctatgggaaa tataagaatc       600
     cttaccacaa ccagatccac gcagccgacg tgacccagac tgtccattgc ttccttctcc       660
     gcacaggcat ggtgcactgc ctgtcagaga ttgaggtctt ggccatcatc tttgctgcag       720
     ccatccatga ctatgagcac acaggcacaa ccaacagctt ccacattcag accaagtcag       780
     aatgtgccat cctgtacaat gatcgatcgg tgctggagaa tcaccacatc agctctgtct       840
     ttcgaatgat gcaggatgat gagatgaaca tttttatcaa tctcaccaag gatgaatttg       900
     cagagctgcg ggccctggtt atcgagatgg tgttggccac agacatgtcc tgccatttcc       960
     agcaagtgaa gactatgaag acagcactgc agcagttgga aaggattgac aagtccaagg      1020
     ccctatctct tctgcttcat gctgctgaca tcagccaccc aactaagcag tggtcagtcc      1080
     acagccgctg gaccaaggcc ctaatggaag agttcttccg ccagggtgac aaggaggcag      1140
     agctgggcct gcccttctct ccactctgtg atcgcacttc cacattggtg gcccagtccc      1200
     agataggttt cattgacttc attgtggagc caaccttctc tgtgctgact gatgtggcag      1260
     aaaagagtgt ccagcccttg gcagatgatg attccaagcc taaaagtcag cccagcttcc      1320
     agtggcgcca gccttcttta gatgtggacg taggagaccc caaccctgat gtggtcagtt      1380
     tccgtgccac ctggaccaag tacattcaag agaacaaaca gaagtggaag gaacgggcag      1440
     caagtggcat caccaaccag atgtccattg atgaactgtc cccctgtgag gaagaagccc      1500
     catcctcccc tgcagaagat gagcacaacc agaatgggaa tctggattag ggaactgggg      1560
     gctgaccagg tcctcactga gtccaaagtc ttcgatgtca ttagcactat ccatcaggac      1620
     tggttccccc atctgctcca agggagtgtg ttggttgtgg gaaagacagc tcacctaaga      1680
     gccaaatgtt ggagcgggtg gggtgtggga agggcccctc cccacccaca ggccctcagt      1740
     ggtcactgtg cccatccctt gcctctggac tcctcctttg gccacttggg aggagtaagc      1800
     tccctgcagg cttcctacag tttggagggg agggtcagag atgccagccc cctgggccct      1860
     ccccatcctt cttgcctcca agtttctaag caatacattt tgggggttcc ctcagtcccc      1920
     caccccagat cttagctggc aggtctgggt ttcccttctc ttccctgaga aagggccaga      1980
     ataggatagg aagctggcag ttttcaaagc cctgcatggg aagggcaggt gtcccttcag      2040
     gttccttcct aagatgaggt gggggacatc ctcttgatcc catacttgca cttcttcagc      2100
     cccattccct tgcaaattct ctctctcctg tgcccagaca gtggctggga gaggagagga      2160
     gccattggga ttctgtctga gggaagtctt tcctggagtc ctcaaatact tggggatggt      2220
     ctgggcttga ggggcttgta ccctgatcta gatgggtttt tgaccctttg cctccttcct      2280
     gtccccggga actaggaagc cctcatccga ccaatgtctg taaacgctct gaggtcttcc      2340
     ttcaggatgt atcttatgag caaaggaagg agagagcagc tagccccagt acaagcaggg      2400
     ggaagtatta cccagtaatg ttgacacaga gcaggtcctt cctgcctccc ttctccccga      2460
     actggcccac taagagattt ccccctcccg gggcccctgg tgggtggaag gcagatgggg      2520
     aggggctcag ggcggtagca acttggagca cccagagcga gtgcagccag gtaaagcctc      2580
     ttcctgtcct caggctcctt gccccacgtc accccattta aggccaagtc caggtgactg      2640
     cctcctcctc tcttgtaaat acatgcattt gtacagtggg ccctgttctt gtgaagtcca      2700
     tctccatggt cattagacct gccactctga accgcatgtg actcccccat gctcttggtc      2760
     tcccaggccc ctgctatagc cagagatcaa taaagaaggg agaccggc                   2808
//