spacer

EBI Dbfetch

ID   AK004689; SV 1; linear; mRNA; HTC; MUS; 2586 BP.
XX
AC   AK004689;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male lung cDNA, RIKEN full-length enriched library,
DE   clone:1200010C18 product:N-myc downstream regulated 3, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2586
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2eb633ce47a0f890ce5e973f54415f12.
DR   Ensembl-Gn; ENSMUSG00000027634; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072298; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1200010C18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2586
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1200010C18"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             105..1232
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="N-myc downstream regulated 3 (MGD|MGI:1352499)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q544I1"
FT                   /db_xref="InterPro:IPR004142"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:1352499"
FT                   /db_xref="UniProtKB/TrEMBL:Q544I1"
FT                   /protein_id="BAB23475.1"
FT                   /translation="MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETPHGMVHVT
FT                   IRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSF
FT                   PTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINI
FT                   DPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQANLDLIQTYRLHIAQDINQENL
FT                   QLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPIN
FT                   TTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSIGSGE
FT                   SPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC"
FT   polyA_signal    2561..2566
FT                   /note="putative"
FT   polyA_site      2586
FT                   /note="putative"
XX
SQ   Sequence 2586 BP; 666 A; 657 C; 604 G; 659 T; 0 other;
     ggctgctgct gctgctgccg ctgctgctgt agattgacgg ccccgcgcta gcgcttcaga        60
     gttcctggtt catccttgag actcatctgc tctgagccat cctcatggat gaacttcagg       120
     atgttcaact cacagagatc aaaccgcttc taaatgataa gaatggcaca cgaaacttcc       180
     aggactttga ctgtcaggaa catgacattg aaacaccgca tggtatggtc cacgtcacca       240
     taagaggctt accaaaagga aacagacctg ttatcctgac ataccacgac attgggctca       300
     accataagtc ctgcttcaac acattcttca actttgagga tatgcaagag atcacccagc       360
     actttgctgt ctgtcacgtg gacgctcctg gccaacaaga agcagcaccc tccttcccca       420
     cagggtacca gtaccccacc atggatgagc tagctgagat gctgcctcct gttctcacac       480
     acttaagtat gaagagcatc attggtattg gggttggagc aggagcctac attctcagca       540
     gatttgcact gaatcatcca gagctggtgg aaggtcttgt gctcattaac attgacccgt       600
     gtgctaaggg ctggattgac tgggcagctt ccaaactctc aggttttacc accaacattg       660
     tggacataat tctggctcat cactttggcc aggaggagtt gcaggccaat ttggacctca       720
     ttcaaaccta cagactgcac attgctcaag atatcaacca agaaaacctc cagctcttcc       780
     tgggttccta taatgggcgc agagacctgg agatcgaaag gcctatactg ggccaaaatg       840
     ataacagatt gaaaacgcta aagtgttcta ccttactggt ggtgggggac aattcacctg       900
     ctgtggaggc tgtggttgaa tgtaattctc gcctcgaccc tataaataca actttgctaa       960
     agatggcaga ctgtggagga ctgccccaag tagttcagcc tgggaagctc accgaggcct      1020
     tcaagtactt tttgcaggga atgggctaca taccatctgc cagcatgacc cggctcgccc      1080
     gatcacgaac ccactccacc tcaagtagca ttggctctgg agaaagtccc tttagcaggt      1140
     ctgtgaccag caatcagtca gatggaactc aagaatcctg tgagtcccct gatgtcctgg      1200
     acagacacca gaccatggaa gtgtcttgct aagcagatct cctcccctgg accatgcaag      1260
     tccctctcct tgaaatgacc actccgtaat agaacatttc attccgtcag ctggccccca      1320
     cttcctttca ctcacgcatg gccacagcat ctctctctag tagccgagag tgtcattctc      1380
     tccacccttt ctgtgtgtac cagagccaca cccatgccat tactgtaaca ttccaacatc      1440
     tccatctgac ctgacctcca tatcttctct tgccagcctt tccctatgct ccctcaaata      1500
     tgtatctgat gagattcttt aattcccaac tccatgtgtg tgcgagcacg cgtgtctgtg      1560
     tctgtgtgtg catacttctg tgactttaga catgctttct tgtagtgctt ctgcaaaggg      1620
     actttttttg aatcctcagt ggcatttttt taagggaaat atgcagagtg gatatctggg      1680
     tgggttgggc cacaagattg gattttggtt ccacttggac aacaaacagt atttgcagag      1740
     tgatttcagg agagagcagg tctgaggaat atgcaaaact gtagttactg tgtgggccat      1800
     tgactgcctt gaccagtaga agggataact attacacaga taggcaggca gggtggcagt      1860
     cacctcccct gtccacgtgg atccatccct gccattgtgt gagtcagagg gatagatctg      1920
     aagcctgtga atgatgtctg gtacaccaca gtgttttctc cagagaactg gcctaagctc      1980
     tagattagcc aagaaagctg gaaaacagag cgccaggctt cactctgcag agagaaagtg      2040
     ctctgtccct gtagcgtctg attccactta ccagacaccc acgcatctgc aggatgtctg      2100
     atgcagagcg gttctccatc cctcagttcc agaaaaaatg gagtgatatt taaaaatgcc      2160
     atcgatggtg gggatcttac tggggaagag gaaggaccat tagcacacca tcatgatgtc      2220
     agatgacaaa atggaagcca agacaccttg aaggtgactt tctaggaagg tcttaagcat      2280
     gtaatgtccc tttatcagag ggaaggggac aaactcaggg cagccctgtc caggtagaaa      2340
     tatttttgcc cccctgtctg atgttgatga ggggtcatac cagccaggga gaccctctgg      2400
     gaggaagctg ccacacacaa ggactctgga agtatccaga tgtgagccca gccagggtcc      2460
     tatggttcca aatctgaaga aaaggttttt cacacactcc ttgctttctg ctaagataag      2520
     aaaggcgtca ctctgccaga gtgtgacttt ttacagatta aataaagctg tatatgtctc      2580
     attgtt                                                                 2586
//


spacer
spacer