spacer

EBI Dbfetch

ID   AK004686; SV 2; linear; mRNA; HTC; MUS; 2779 BP.
XX
AC   AK004686;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus adult male lung cDNA, RIKEN full-length enriched library,
DE   clone:1200010B19 product:protein phosphatase 1, catalytic subunit, beta
DE   isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2779
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a3e5c58fe588232e2c257d00a0364da6.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131300; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1200010B19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2779
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1200010B19"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             98..1081
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1, catalytic subunit, beta
FT                   isoform (MGD|MGI:104871, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="MGI:MGI:104871"
FT                   /protein_id="BAB23473.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVEEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
XX
SQ   Sequence 2779 BP; 795 A; 468 C; 569 G; 947 T; 0 other;
     ggaaacgccg cgtgactcgt aggtgagaac gccgagccgc cgccgccgcc gagaagccct        60
     gttaacgctt tagggaggag agtctggtgc cgacaagatg gcggacgggg agctgaacgt       120
     ggacagcctc atcacccgcc tgctggaggt acgaggatgt cgtccaggaa agattgtaca       180
     aatgactgaa gcagaagtcc gagggttgtg tatcaagtct cgtgaaatct ttctcagcca       240
     gcctattctt ttggaattgg aagcaccact gaagatttgt ggagacattc atggacaata       300
     tacagactta ctaagattat ttgaatatgg aggttttcca ccagaagcca actatctttt       360
     cttaggagat tatgtggaca gaggaaagca gtctttggaa accatctgtt tgctattggc       420
     ttacaaaatc aaatacccgg agaacttctt tcttctaaga ggaaaccatg agtgtgctag       480
     catcaatcgc atttatggat tctacgatga gtgtaaacga agatttaata ttaaattgtg       540
     gaagacattc actgattgtt ttaactgtct gcctatagct gctattgttg atgagaaaat       600
     cttctgttgt catggaggac tgtcaccaga cctacaatct atggaacaga ttcggagaat       660
     tatgagaccc actgacgtac ctgatacagg tttgctttgt gacttactgt ggtccgaccc       720
     agataaggat gtgcaaggct ggggagaaaa tgaccgtggt gtttctttta cttttggagc       780
     tgatgtagtc agtaaatttc tgaatcgtca tgatttagac ttgatttgtc gagctcatca       840
     ggtggaggaa gacggatatg aattttttgc taaacgacag ttggtaacct tattttctgc       900
     cccaaattac tgtggcgagt ttgacaatgc tggtggtatg atgagtgtgg atgagacttt       960
     gatgtgttca ttccagatat tgaaaccatc tgaaaagaaa gctaagtacc agtatggtgg      1020
     gctgaattct ggacgtcctg tcactccgcc tcgaacagct aatccaccga agaaaaggtg      1080
     aagacaggaa ttctagaaag agaaaccatc agatttgtta aggacatact tcataatata      1140
     taagtgtgca ctgtaaaacc atccagccat tcgacaccct ttatgatgtc acacctttaa      1200
     cttaaggaga cggtaaagga tcttaaattt ttttctaata gaaagatgtg ctacactgta      1260
     ttgtaataag tatactctgt tataatattc aacaaaatta aatccaaatt caaaagtatc      1320
     cattaaagtt ctatcttctc atatcacagt ttttaaagtt gaaaagcatc ccagttaaac      1380
     tagccctgtt agtgacccag atgaaagcat gaagatccat ctgtgtaatg tggttttagt      1440
     ggtgcttggt tgtttcatta ttttgagctt gttttgtttt gtttgttttt gctagaataa      1500
     tggcatctac ttttcctatt tttccctaaa catttttaaa agtgaaaatg ggaagagctt      1560
     taaagacatt caccaactat tcttttcctt tacttatcta cttaagtaac tgttggatct      1620
     tactaagaaa acttacccct cattacagta aaaaggaact ttagaggtcg ataggtttta      1680
     aaaatataca aactatctga tccattgatt ttaatcaaac agtttgactg ggcaaacttt      1740
     gcagctgata atgagtattt cgctttttac aaaattgcca ctgatttgga tttgtgcact      1800
     ctaatcttta atttattgat gctctattgt gcagtagcat ttcatttaag ataaggctca      1860
     tatagtaata tccaaaacta gttggtaatg tgattatgtg gtactttggc tttgggttct      1920
     aattcgcacg aaacaccttt tggcatgctt aactttctgg tattaccctc acctgcattg      1980
     gttttgtttt ttggggtttt tgttgtttgt ttgtttttag attcacagaa catgagaatc      2040
     ctttttgaca agccttggat agctggctct cttctttccc tctctctatg tgaaggatgt      2100
     atttaaatga acgctggtca gtgggacatt tgtcagctct gaatattggg tgcttcacta      2160
     ataattgcca tgtgaatgtt gttttgactg taaggctatg tcactaaaga tttttactct      2220
     gcgttttcat aatcaaaggt catgatgtgt atagacatgc tttgtagtga agtatagtag      2280
     caataatttc tgtatgtgat caagagttta ttgcattatt tctttccctg ttctcttttt      2340
     tttttttttt taagggttag cattaacaaa tgtcaaggag tagcaaagtc aacaaagatt      2400
     ttagaaggag gaggaactaa gagcatacac agacttatga ttctttggat gtgacactta      2460
     ttggatgtga ttctaaagtc ttttattgaa cattgtcaaa ttcgtacgct tcataggatg      2520
     gacataatgt ttatataatg cccttcttat gtgttaccat agatgtgtga aaccttatag      2580
     cgtccttgaa agtgttaaat tgagaactct gttaacattt tatggattga cacattatat      2640
     tactgcaagt aacatttgat tttcagcaca gtgcaaaagt tctttaaaat gcatatgtct      2700
     ttttttttct aattccattt tgtttaaagc acattttaaa tgtagttttc tcatttagta      2760
     aaagttgtct aattgatac                                                   2779
//


spacer
spacer