spacer

EBI Dbfetch

ID   AK004651; SV 1; linear; mRNA; HTC; MUS; 3140 BP.
XX
AC   AK004651;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus adult male lung cDNA, RIKEN full-length enriched library,
DE   clone:1200008D17 product:matrix metalloproteinase 9, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3140
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 60f7a967bff30a52596d1d0fafe9e7db.
DR   Ensembl-Gn; ENSMUSG00000017737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017881; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1200008D17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3140
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1200008D17"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             20..2212
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="matrix metalloproteinase 9 (MGD|MGI:97011)"
FT                   /note="putative"
FT                   /db_xref="GOA:P41245"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028688"
FT                   /db_xref="MGI:MGI:97011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41245"
FT                   /protein_id="BAB23442.1"
FT                   /translation="MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQL
FT                   AEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPD
FT                   VGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPE
FT                   ADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYY
FT                   GNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHG
FT                   NGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGG
FT                   NSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVA
FT                   AHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTT
FT                   TEPQPTATPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTA
FT                   GSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTAR
FT                   TWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLL
FT                   PRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHG
FT                   KFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP"
FT   polyA_signal    3125..3130
FT                   /note="putative"
FT   polyA_site      3140
FT                   /note="putative"
XX
SQ   Sequence 3140 BP; 677 A; 931 C; 810 G; 722 T; 0 other;
     aaaagctgcg gtcctcacca tgagtccctg gcagcccctg ctcctggctc tcctggcttt        60
     cggctgcagc tctgctgccc cttaccagcg ccagccgact tttgtggtct tccccaaaga       120
     cctgaaaacc tccaacctca cggacaccca gctggcagag gcatacttgt accgctatgg       180
     ttacacccgg gccgcccaga tgatgggaga gaagcagtct ctacggccgg ctttgctgat       240
     gcttcagaag cagctctccc tgccccagac tggtgagctg gacagccaga cactaaaggc       300
     cattcgaaca ccacgctgtg gtgtcccaga cgtgggtcga ttccaaacct tcaaaggcct       360
     caagtgggac catcataaca tcacatactg gatccaaaac tactctgaag acttgccgcg       420
     agacatgatc gatgacgcct tcgcgcgcgc cttcgcggtg tggggcgagg tggcacccct       480
     caccttcacc cgcgtgtacg gacccgaagc ggacattgtc atccagtttg gtgtcgcgga       540
     gcacggagac gggtatccct tcgacggcaa ggacggcctt ctggcacacg cctttccccc       600
     tggcgccggc gttcagggag atgcccattt cgacgacgac gagttgtggt cgctgggcaa       660
     aggcgtcgtg atccccactt actatggaaa ctcaaatggt gccccatgtc actttccctt       720
     caccttcgag ggacgctcct attcggcctg caccacagac ggccgcaacg acggcacgcc       780
     ttggtgtagc acaacagctg actacgataa ggacggcaaa tttggtttct gccctagtga       840
     gagactctac acggagcacg gcaacggaga aggcaaaccc tgtgtgttcc cgttcatctt       900
     tgagggccgc tcctactctg cctgcaccac taaaggccgc tcggatggtt accgctggtg       960
     cgccaccaca gccaactatg accaggataa actgtatggc ttctgcccta cccgagtgga      1020
     cgcgaccgta gttgggggca actcggcagg agagctgtgc gtcttcccct tcgtcttcct      1080
     gggcaagcag tactcttcct gtaccagcga cggccgcagg gatgggcgcc tctggtgtgc      1140
     gaccacatcg aacttcgaca ctgacaagaa gtggggtttc tgtccagacc aagggtacag      1200
     cctgttcctg gtggcagcgc acgagttcgg ccatgcactg ggcttagatc attccagcgt      1260
     gccggaagcg ctcatgtacc cgctgtatag ctacctcgag ggcttccctc tgaataaaga      1320
     cgacatagac ggcatccagt atctgtatgg tcgtggctct aagcctgacc caaggcctcc      1380
     agccaccacc acaactgaac cacagccgac agcaactccc actatgtgtc ccactatacc      1440
     tcccacggcc tatcccacag tgggccccac ggttggccct acaggcgccc cctcacctgg      1500
     ccccacaagc agcccgtcac ctggccctac aggcgccccc tcacctggcc ctacagcgcc      1560
     ccctactgcg ggctcttctg aggcctctac agagtctttg agtccggcag acaatccttg      1620
     caatgtggat gtttttgatg ctattgctga gatccagggc gctctgcatt tcttcaagga      1680
     cggttggtac tggaagttcc tgaatcatag aggaagccca ttacagggcc ccttccttac      1740
     tgcccgcacg tggccagccc tgcctgcaac gctggactcc gcctttgagg atccgcagac      1800
     caagagggtt ttcttcttct ctggacgtca aatgtgggtg tacacaggca agaccgtgct      1860
     gggccccagg agtctggata agttgggtct aggcccagag gtaacccacg tcagcgggct      1920
     tctcccgcgt cgtctcggga aggctctgct gttcagcaag gggcgtgtct ggagattcga      1980
     cttgaagtct cagaaggtgg atccccagag cgtcattcgc gtggataagg agttctctgg      2040
     tgtgccctgg aactcacacg acatcttcca gtaccaagac aaagcctatt tctgccatgg      2100
     caaattcttc tggcgtgtga gtttccaaaa tgaggtgaac aaggtggacc atgaggtgaa      2160
     ccaggtggac gacgtgggct acgtgaccta cgacctcctg cagtgccctt gaactagggc      2220
     tccttctttg cttcaaccgt gcagtgcaag tctctagaga ccaccaccac caccaccaca      2280
     cacaaacccc atccgaggga aaggtgctag ctggccaggt acagactggt gatctcttct      2340
     agagactggg aaggagtgga ggcaggcagg gctctctctg cccaccgtcc tttcttgttg      2400
     gactgtttct aataaacacg gatccccaac cttttccagc tactttagtc aatcagctta      2460
     tctgtagttg cagatgcatc cgagcaagaa gacaactttg tagggtggat tctgaccttt      2520
     tatttttgtg tggcgtctga gaattgaatc agctggcttt tgtgacaggc acttcaccgg      2580
     ctaaaccacc tctcccgact ccagcccttt tatttattat gtatgaggtt atgttcacat      2640
     gcatgtattt aacccacaga atgcttactg tgtgtcgggc gcggctccaa ccgctgcata      2700
     aatattaagg tattcagttg cccctactgg aaggtattat gtaactattt ctctcttaca      2760
     ttggagaaca ccaccgagct atccactcat caaacattta ttgagagcat ccctagggag      2820
     ccaggctctc tactgggcgt tagggacaga aatgttggtt cttccttcaa ggattgctca      2880
     gagattctcc gtgtcctgta aatctgctga aaccagaccc cagactcctc tctctcccga      2940
     gagtccaact cactcactgt ggttgctggc agctgcagca tgcgtataca gcatgtgtgc      3000
     tagagaggta gagggggtct gtgcgttatg gttcaggtca gactgtgtcc tccaggtgag      3060
     atgacccctc agctggaact gatccaggaa ggataaccaa gtgtcttcct ggcagtcttt      3120
     tttaaataaa tgaataaacg                                                  3140
//


spacer
spacer