spacer

EBI Dbfetch

ID   AK004506; SV 1; linear; mRNA; HTC; MUS; 1311 BP.
XX
AC   AK004506;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:1190006E07 product:hypothetical protein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1311
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2e19e5ebead23cc6521c49707e1c8ded.
DR   Ensembl-Gn; ENSMUSG00000004843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004965; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1190006E07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1311
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-day embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1190006E07"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..304
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="hypothetical protein (evidence: CDS)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8BJF9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="MGI:MGI:1916192"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJF9"
FT                   /protein_id="BAB23339.1"
FT                   /translation="KXMDPQKTLQTMQNFQKDNMKMEMTEEMINDTLDDIFDGSDDEEE
FT                   SQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD"
FT   polyA_signal    1293..1298
FT                   /note="putative"
FT   polyA_site      1311
FT                   /note="putative"
XX
SQ   Sequence 1311 BP; 417 A; 228 C; 262 G; 403 T; 1 other;
     taagnaaatg gatccacaga agacactaca aacaatgcag aatttccaga aggacaacat        60
     gaaaatggaa atgactgaag aaatgatcaa tgacaccctg gatgacatct ttgatggctc       120
     tgatgatgaa gaagaaagcc aggacatcgt gaatcaagtt cttgatgaaa ttgggattga       180
     aatctctgga aagatggcca aagctccatc ggctgcaaga agcttaccgt ctgcctccac       240
     ttcaaaggct acaatttctg atgaagagat tgaacgtcaa ctcaaagctt taggggtaga       300
     ttagatcaaa agccatacat actgttctca cttgagtcta aagtgagtgc ggtgtagatt       360
     ccttttacaa aacacattca ttttgcaaaa atgaagacca tgagtgaaca gttatttcct       420
     gacccatggc tactttgaat cctttgccaa agagtgccaa tgatgcaaaa aacaatggga       480
     gcagtttggc tcttaggtag aagcaccctg gtctgagggg tgtgcaagct gagttctttt       540
     gtgcatggca tagggagacg acggtgtcac tgcttagtgt tgggttgggt tctaagttgt       600
     tttacactga aatcagactt catgtttaat gccattaggc gtcaacgtaa agagacttgt       660
     aaaaatatta aaggtatatc gttaattctg tatctgttgc ttgtcctttg tagacagtta       720
     tgttaggacc ataggcagtg cagctgccaa gttattttta aaccatctaa aaggagagtg       780
     ctatttaaac atctgtctta aactgtcctg agcttctact tttcttccat ttaccccctt       840
     tgggagaaca ttctagttgg taagtttatt acctttcaaa atgtgcttgg cacctgcctt       900
     aaatagcacg aacatattgt gcacatcttt aaattaattt aactggcaaa aaaacaatta       960
     cattttaaac taaaactgag actgagaaca gtacccaatc tgtcttttaa agcttataaa      1020
     agtgaatcgg gtacaattag caaaaagaag aaagaagaca ctgaatttat gacgttttac      1080
     agtaatgaag ctatactttg gtctttcttc caagaactgc gatttttctc tgtatgaatt      1140
     ataacttagt ctgtgttgga actttgaatt gtgtaatata cacattaaac catctaaatt      1200
     gaagccattc ttctaaagga aggactgcta ctttgacagt acttgatcca gatttctaaa      1260
     gaaaatgttt ttgttttgtt gtgtttttgg taaataaact gcaactttgt c               1311
//


spacer
spacer