spacer

EBI Dbfetch

ID   AK004464; SV 1; linear; mRNA; HTC; MUS; 1219 BP.
XX
AC   AK004464;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:1190003C14 product:STIP1 homology and U-Box containing
DE   protein 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1219
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5a2880c85096ac956b24aa2c3030bc3b.
DR   Ensembl-Gn; ENSMUSG00000039615; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044911; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1190003C14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1219
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-day embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1190003C14"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             57..971
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="STIP1 homology and U-Box containing protein 1
FT                   (MGD|MGI:1891731, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9WUD1"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1891731"
FT                   /db_xref="PDB:2C2L"
FT                   /db_xref="PDB:2C2V"
FT                   /db_xref="PDB:3Q47"
FT                   /db_xref="PDB:3Q49"
FT                   /db_xref="PDB:3Q4A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUD1"
FT                   /protein_id="BAB23315.1"
FT                   /translation="MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPE
FT                   AAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQC
FT                   QLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELH
FT                   SYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEK
FT                   RKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL
FT                   IPNLAMKEVIDAFISENGWVEDY"
FT   polyA_signal    1201..1206
FT                   /note="putative"
FT   polyA_site      1219
FT                   /note="putative"
XX
SQ   Sequence 1219 BP; 262 A; 332 C; 389 G; 236 T; 0 other;
     ggggctgcga gatctaggtg gccgggcgcg gagcccaagc cgtgccgcgc ggcgccatga        60
     agggcaagga ggaaaaggag ggcggcgcgc ggctgggcac tggtggcggc ggcagccctg       120
     ataagagccc gagtgcgcaa gagctcaagg agcagggaaa ccggctcttc gtgggccgca       180
     agtacccgga ggcggcggcc tgctacggcc gcgccatcac tcggaaccca cttgtggcag       240
     tgtactacac taaccgggcc ctgtgctatc tgaagatgca gcagcctgaa caggcacttg       300
     ctgactgccg gcgagccctg gagctggacg ggcagtctgt gaaggcgcac ttcttcctgg       360
     ggcagtgcca gctggagatg gagagttatg atgaggccat tgccaatctg cagcgagcct       420
     atagtttggc caaggagcag cgactcaact ttggggatga tattcctagt gcccttcgca       480
     ttgctaagaa gaagcgctgg aacagtatcg aggaacggcg catccaccag gagagtgagc       540
     tgcattcata tctcaccagg ctcattgctg ctgagcgaga gagggaactg gaggagtgtc       600
     agcggaacca cgagggtcat gaagatgatg gccacatccg ggcccagcag gcctgcattg       660
     aggccaagca cgataaatac atggcagata tggatgagct cttctctcag gtggacgaga       720
     aaagaaagaa gcgagatatc cctgactact tgtgtggcaa gattagcttt gagctgatgc       780
     gggaaccctg cattacaccc agtggtatca cctatgaccg caaggacatt gaggagcacc       840
     tgcagcgtgt gggccacttt gaccctgtga cccggagccc tctgacccag gaacagctca       900
     tccccaactt ggccatgaag gaagtcattg acgctttcat ctctgagaac ggctgggtag       960
     aggactattg aggccccatg tcctgcctgg caccctggcc caggaggatc tggagacgga      1020
     agctccagtc cctgtatagt ttgtgtccct gggcctgccc ccatcggccc tgctgatggg      1080
     ttctgaactg ctccccttct cagcataccc cttgctggac catgagcctc ccttgtcccc      1140
     cttctgggct ggagagtggg tgagggtggg ctgaggttgc tgctgctgcc actgtcctgt      1200
     aataaagtct gtgagcact                                                   1219
//


spacer
spacer