Dbfetch

ID   AK004165; SV 1; linear; mRNA; HTC; MUS; 1809 BP.
XX
AC   AK004165;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:1110038N04 product:regulator of G-protein signaling 5, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1809
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 41c4b6a222afc467c8672627d8bcf562.
DR   Ensembl-Gn; ENSMUSG00000026678; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016720; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016700; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016666; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016661; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016485; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017122; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016065; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016460; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016566; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016564; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016637; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016589; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017159; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015851; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016127; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027997; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0023299; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0023272; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0023239; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0023247; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0023049; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0023755; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0022596; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0022997; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0023114; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0023129; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0023218; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0023094; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0023793; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0022317; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0022613; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1110038N04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1809
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-day embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1110038N04"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             79..624
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="regulator of G-protein signaling 5 (MGD|MGI:1098434
FT                   GB|NM_009063, evidence: BLASTN, 98%, match=792)"
FT                   /db_xref="GOA:O08850"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR034955"
FT                   /db_xref="InterPro:IPR034956"
FT                   /db_xref="MGI:MGI:1098434"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08850"
FT                   /protein_id="BAB23201.1"
FT                   /translation="MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPE
FT                   KPAKAHKPSLEEVLQWRQSLDKLLQNSYGFASFKSFLKSEFSEENLEFWVACENYKKIK
FT                   SPIKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSPRSFDLAQKRIYALME
FT                   KDSLPRFVRSEFYKELIK"
FT   regulatory      1780..1785
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1809
FT                   /note="putative"
XX
SQ   Sequence 1809 BP; 523 A; 378 C; 382 G; 526 T; 0 other;
     gagattattg aagtttccac agacggtcag ctgttgagag gttcgtgctc aagttgagga        60
     tctaagccgc cagccaaaat gtgtaaggga ctggcagctc tgccgcactc atgcctggaa       120
     agggccaagg agatcaagat caagttggga attctcctcc agaagccaga ctctgctgtt       180
     gaccttgtca ttccatacaa tgagaagcca gagaagcctg ccaaggcaca caagccctca       240
     ctggaggagg tcctgcagtg gcgccagtcc ctggacaagc ttctccagaa cagctatgga       300
     tttgccagct tcaaaagttt cctgaagtct gaattcagtg aggaaaacct tgagttctgg       360
     gttgcctgtg agaattacaa gaagatcaag tcccccatca aaatggcgga gaaggcaaag       420
     caaatttatg aagaattcat ccagacagag gcccctaaag aggtgaacat tgaccacttc       480
     actaaagaca tcaccatgaa gaacctggtg gaaccgtctc ctcgcagctt tgacttggcc       540
     cagaaaagga tctatgccct gatggagaag gattctctgc cccgctttgt gcgctctgaa       600
     ttttataagg agctaatcaa gtagtcatct ggtcaggctt ccaaaagttg ccctgtgagt       660
     tgagttacat cctttgtagc aacacagcat cctcccaggc acctgcacag ttctccatag       720
     cagctttgct ccaagataca caaacatagg caaaccacag gctgtgttgc taactctttc       780
     gctcatgtta gtttggttat gtggatctgt tgtctaagag cctcactttt ttctttttct       840
     tttttctttc tttttcttgg ttctttctga ctgcttgtaa tagagattta caagtcattg       900
     tcagtctaag tcacaataat atccagttta acataaagct gtctgtgcaa agaataggtg       960
     tagactgcta tgttaaccag gctgaaaaga aagacagatg caagtgtccc ctttcatggg      1020
     gatttgactg gtcttgttta ttgttttaat tcttattctc taatggcttc agaatttggt      1080
     tagtaaaata gcagcaagct ggtcataagg cagccaccgt tgggtttttc agcaaatgca      1140
     ttatttaaca ctactgatct ctcctttcta gagtaccgct gtgttatctg gacattctca      1200
     ataagagata caatgaatac attgtgcttc taaacaggat tcatttcaat cctgcccttc      1260
     atgtttccaa atctcgaggg gaaaatggca gcctttgact ttctcgaaca attagaaatg      1320
     ctaatgccca gacatttttt gagctgtttc ttaaacaatg gaaacaataa tttaaaatta      1380
     atattttctt cacattagtt ggaatagccg aatgtctgaa aatacccaag gagtgaaccg      1440
     gctgttacac actcactcag atgcctcctg tcattgtaac ctcaattgac tctgctcaca      1500
     aattgtgtga ttggttagtc ttgtcagtgc agggtgagaa gggtaggaag ggtgcctcaa      1560
     gggcagtgct gtgaggccac aaaaggatgc aggcaggcat gcttctgcag tctaagggct      1620
     gcattatata tccagatatt tactgtatca ctatataatt ttaaatttag agcaatatat      1680
     atacatacac acacacatat atatacatat atatttttct aatatataaa atactcaatg      1740
     ggcgataagt agtctagttc caaaggaaaa gccaaatgta ttaaaattgg actagaaact      1800
     atttgtagg                                                              1809
//