Dbfetch

ID   AK003837; SV 1; linear; mRNA; HTC; MUS; 1514 BP.
XX
AC   AK003837;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:1110020A06 product:UDP-Gal:betaGlcNAc beta
DE   1,3-galactosyltransferase, polypeptide 3, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1514
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 87a321d08e8d537ef267b6344e5bb2ea.
DR   Ensembl-Gn; ENSMUSG00000043300; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027296; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027258; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027226; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027269; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027013; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027715; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026460; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026988; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027124; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027092; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027232; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027111; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027773; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026194; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026538; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000061826; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061187; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0061211; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0061147; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061136; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060830; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061614; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061124; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0060806; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0060902; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0060887; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0061045; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060856; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061800; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060679; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060104; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1110020A06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1514
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-day embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1110020A06"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..769
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,
FT                   polypeptide 3 (MGD|MGI:1349405)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q920V1"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1349405"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q920V1"
FT                   /protein_id="BAB23028.1"
FT                   /translation="NPFLVILVTSRPSDVKARQAIRVTWGEKKSWWGYEVLTFFLLGQQ
FT                   AEREDKTLALSLEDEHVLYGDIIRQDFLDTYNNLTLKTIMAFRWVMEFCPNAKYIMKTD
FT                   TDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFFHKNHISYQEYPFKVFPPYCS
FT                   GLGYIMSGDLVPRVYEMMSHVKPIKFEDVYVGICLNLLKVDIHIPEDTNLFFLYRIHLD
FT                   VCQLRRVIAAHGFSSKEIITFWQVMLRNTTCHY"
XX
SQ   Sequence 1514 BP; 449 A; 288 C; 323 G; 454 T; 0 other;
     aaacccattc ctggtcatcc tggtgacctc acgcccctca gatgtgaaag ccagacaagc        60
     cattagagtt acttggggtg agaaaaagtc ctggtgggga tatgaggtgc tcacgttttt       120
     cttactaggc cagcaggctg aaagggaaga caaaacgtta gccctgtcct tggaggatga       180
     gcacgttctc tatggtgata ttatacggca agactttcta gacacatata ataacttgac       240
     cttgaaaacc attatggctt tcaggtgggt aatggagttt tgccccaatg ccaagtatat       300
     catgaaaaca gacactgatg ttttcatcaa cactggcaat ttagtcaagt atcttttaaa       360
     cctaaaccac tcagagaagt ttttcacggg ctatcctcta attgataact attcctatag       420
     aggatttttc cataaaaacc acatttcata ccaagagtac cccttcaagg tgttccctcc       480
     ctactgcagc gggctgggct acattatgtc cggcgacctg gtgcccaggg tctacgagat       540
     gatgagtcac gtgaagccca tcaagtttga agacgtttat gttggcatct gtttgaattt       600
     gttaaaagtg gacattcata ttccagaaga cacaaacctt ttctttctgt acagaatcca       660
     cttggatgta tgtcagctca gacgcgtgat tgcagcccat ggcttttctt ccaaggagat       720
     catcacattc tggcaggtga tgctgaggaa caccacatgc cattactaag cccatccatc       780
     acccatctag gcaagggagg aaggacactg tagacagggt cagagttagc actgtgggaa       840
     actcgggaag ttgagcatgc tggtttgcct gggctgaaac tcatggagct ccctagacag       900
     gagtcaaggc ctgaacttag tgattgcttt cacagaattt aacttgggtc gtttaaaggt       960
     gacagaggag tcaaacataa tgcaaacgaa gagttttgct aaccaaatca aagggtcaga      1020
     cagtctggat ggctcaggct gtagattaga atttcttaag atttccctaa aagaaaaact      1080
     aactagtcca cagccagaat acagtgtgga gttgtattta ttagacagta tagttacata      1140
     atggttcagt gtgtatctta agtggttatt atgtaaagat atatatatat atttcttgta      1200
     aaaagcttta cagagttata ttgaaaacat tcatttgtat tgttttcatt tgcaaggtac      1260
     tcaatgatat ggtacgtaag agttatcaaa tcaagtatta tttaatgtca tttcaatttt      1320
     ctaaatgttt aaaggttatg tatggtctca gtattatatg atgaattgcc tttcacattt      1380
     gagctttgtt ttattcacca ctgatcagtt taattaatgt ggcgttaatg tgacatcaaa      1440
     ggttattact gactgtccgt aatctgttga actctgttgc actgtaaaca tagagaatta      1500
     aagcaagaaa atcc                                                        1514
//