spacer

EBI Dbfetch

ID   AK003703; SV 1; linear; mRNA; HTC; MUS; 1432 BP.
XX
AC   AK003703;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:1110014J22 product:AMINOACYLASE-1 (EC 3.5.1.14)
DE   (N-ACYL-L-AMINO-ACID AMIDOHYDROLASE) (ACY-1) homolog [Homo sapiens], full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1432
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 16121a09f9b9d832179406a14fe961f6.
DR   Ensembl-Gn; ENSMUSG00000023262; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024031; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1110014J22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1432
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-day embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1110014J22"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             121..1347
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="AMINOACYLASE-1 (EC 3.5.1.14) (N-ACYL-L-AMINO-ACID
FT                   AMIDOHYDROLASE) (ACY-1) homolog [Homo sapiens]
FT                   (SWISSPROT|Q03154, evidence: FASTY, 85.3%ID, 100%length,
FT                   match=1224)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q99JW2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010159"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="MGI:MGI:87913"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99JW2"
FT                   /protein_id="BAB22948.1"
FT                   /translation="MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQL
FT                   GLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEG
FT                   YIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPE
FT                   FQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKLHKV
FT                   ISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDV
FT                   DMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEP
FT                   EIFPAATDSRFIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALA
FT                   SVPTLPSES"
FT   polyA_signal    1416..1421
FT                   /note="putative"
FT   polyA_site      1432
FT                   /note="putative"
XX
SQ   Sequence 1432 BP; 317 A; 398 C; 415 G; 302 T; 0 other;
     cgggcggccc cgggcggttt tgagattggg agcgacctcg gtggaccctg agttccggcc        60
     acagtctgag aggaaagcac aggactgaga cgtggagaga gcaagccagc acgcggcgcc       120
     atgaccacca aggatcccga gtctgagcac ccctccgtga cgctcttccg ccagtacctg       180
     cgcatctgca ctgtgcaacc caatccagac tatggagggg ccatcacctt cctggaggag       240
     agagcccgcc agctgggtct gagctgtcag aaaatagagg tggtgcctgg ctttgtgatc       300
     actgtgctga cctggccagg caccaacccg tcactcccct ccatcttgct aaactcccac       360
     acagatgtgg tacctgtctt caaggaacat tggcatcacg acccctttga ggccttcaag       420
     gattccgagg gctacatcta tgctaggggc tcccaggaca tgaagagtgt cagcatccag       480
     tacctggaag ctgtgaggag gctgaagagc gagggccacc gattccctag gaccatccac       540
     atgacctttg tgcctgacga ggaggtcgga ggtcacaagg ggatggagtt gtttgtgaag       600
     aggcctgagt tccaggctct gcgggcaggc ttcgttctgg acgagggcct ggccaacccc       660
     acggatgcct ttactgtctt ttatagtgag cggagtcctt ggtgggtaca ggttaccagc       720
     actgggaagc caggccatgc ctcacgcttc attgaggata cagctgcaga gaagttgcat       780
     aaggttataa gctccatctt ggcattccgg gagaaggaaa ggcagaggct gcaggcgaac       840
     cctcacctga aggaaggcgc cgtgacttcg gtgaatctga ccaagcttga aggtggcgtg       900
     gcctataatg tggtacctgc cactatgagt gccagctttg acttccgagt ggcaccagat       960
     gtagacatga aggccttcga gaagcagctg cagagatggt gccaggaagc aggagagggg      1020
     gtcacctttg agtttgctca gaagtttaca gagcctcgaa tgacacccac ggatgattca      1080
     gatccctggt gggcagcttt cagcggagcc tgcaaggcaa tgaacctcac tctggagcca      1140
     gagatctttc ctgctgccac tgacagccgc tttatccggg cggtggggat cccagctctg      1200
     ggcttctcgc ccatgaaccg cacacctgtc ctgctacatg accataatga acggctgcat      1260
     gaggatatat ttctccgtgg ggttgacata tatacaggcc tcctctctgc acttgctagt      1320
     gtgcccaccc tgcctagtga aagctgagcc ccagggcttc caactcttgt actctcagtc      1380
     ctaccactgc caaggatctg tttcccctgc ccagtaataa agccagcatt gg              1432
//


spacer
spacer