spacer

EBI Dbfetch

ID   AK003656; SV 1; linear; mRNA; HTC; MUS; 2100 BP.
XX
AC   AK003656;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:1110013E13 product:LIPOCALIN-1 INTERACTING MEMBRANE RECEPTOR
DE   (LIPOCALIN-INTERACTING PROTEIN) homolog [Homo sapiens], full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2100
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 40c8afd7ef4cbba92af75225032d4005.
DR   Ensembl-Gn; ENSMUSG00000022999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109127; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1110013E13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2100
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-day embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1110013E13"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             110..1579
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="LIPOCALIN-1 INTERACTING MEMBRANE RECEPTOR
FT                   (LIPOCALIN-INTERACTING PROTEIN) homolog [Homo sapiens]
FT                   (SPTR|Q969J4, evidence: FASTY, 95.1%ID, 100%length,
FT                   match=1467)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1E5"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="InterPro:IPR008075"
FT                   /db_xref="MGI:MGI:1289247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E5"
FT                   /protein_id="BAB22919.1"
FT                   /translation="MEAADYEVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFK
FT                   KPAEFTTVDDEDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWL
FT                   NGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTL
FT                   LVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFS
FT                   VTGKLLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQAQR
FT                   VLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAVHILELLIDEAAMPRGMQDAAL
FT                   GQASFSKLGSFGAIIQVVLIFYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCL
FT                   LVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAA
FT                   VRAELIRAFGLDRLPLPVSGFPRASRKKQHQ"
XX
SQ   Sequence 2100 BP; 381 A; 605 C; 593 G; 521 T; 0 other;
     gagaggcgct taggctgggt ccgggtgctt ggcgggcggc ggcggcctca tccccgctcg        60
     tcctccccgg gcccggagac acccccgccc cagtcatgct gagcagagta tggaagcagc       120
     tgactacgaa gtgctatccg tgcgagaaca gctgttccac gacagggtcc gcgagtgcat       180
     catctcaata cttctgtttg caacactcta catcctctgc catatcttcc tgacccgctt       240
     caagaagcct gctgagttca ccacagtgga tgatgaagat gccacagtta acaagattgc       300
     gctggagctg tgcaccttta ccctggcggt cgccctgggc gccgtcttac tcctgccctt       360
     ctccatcatc agcaacgagg tgctgctctc gttgccacgc aactactaca tccagtggct       420
     caatggctcc ctcatccatg gtctgtggaa cctcgttttc ctcttctcca atctgtccct       480
     cgtcttcctt atgccctttg catatttctt cacagagtct gaaggctttg ctggctccag       540
     aaagggtgtc ctgggccggg tctacgagac agtggtgatg ttgatcctcc tcacgctgct       600
     tgtgctgggc atggtgtggg tggcatccgc cattgtagac aatgacaagg ccagcaggga       660
     gtcgctctac gacttctggg agtactacct cccctatctc tactcctgta tctccttcct       720
     cggagttctg ctgcttctgg tgtgcactcc actaggtctc gcccgcatgt tctctgtcac       780
     tgggaagttg ctggtcaagc cccggctact ggaagacctg gaggaacagc tgaactgctc       840
     agcctttgag gaggcagctc tgactcgaag aatctgcaat cccacctcct gctggctgcc       900
     actggacatg gaactgctgc atagacaggt cctggctctg caggcacaga gggtcctctt       960
     ggaaaagcgt cggaaggcgt cagcctggca acggaacctg ggctaccctc tggccatgct      1020
     gtgcttgctg gtgctgacgg gcctgtctgt cctcatcgtg gctgtccaca tcctggagct      1080
     gcttattgac gaggctgcca tgccacgggg catgcaggat gctgccctag gccaggcctc      1140
     cttctccaaa ctgggatcct ttggcgccat catccaggtt gtgctgatat tttacctgat      1200
     ggtgtcctca gtggtgggtt tctacagctc tccactcttt ggaagcctga ggcctaggtg      1260
     gcatgacaca tcgatgacac agatcattgg gaactgtgtc tgcctcctgg tcctcagctc      1320
     agcacttcct gtcttctcta gaactcttgg cctgacacgc tttgacctgc tgggtgactt      1380
     tggacgcttc aactggctag gcaatttcta catcgtgttc ctctacaacg cagcctttgc      1440
     tggcctcacc acactctgtc tggtgaagac cttcacggca gctgtgaggg cagagctgat      1500
     ccgagccttt gggctggaca gactgccact gcctgtctct gggtttcccc gggcttctag      1560
     gaagaagcag catcaatgac ctccagctgg gggctgagaa ggagagaact gggcagtgcc      1620
     taggcctggc ggtgagcccc agggggctgc acctcaggac ctggaacctg agagtaggtg      1680
     acagagggga cggaccatct gcactgttgc ttaatctgag ccagagtttg ggacccggct      1740
     ggcctcctgc cttttcagat gtagctgtgg cctgagcatc catctggtgg agctggggga      1800
     ctcgctctag ttcctggacc caaatacgtt tacacatcta tctgcctcaa tcctgttcca      1860
     ggccatgcct gaagccatgt ttacatgatt tgatgtgcaa tagggtgggt gggacttggg      1920
     gggactgggc caggggtagg ttctggagac aggtcttcct tgcctctggc ccagaagagc      1980
     cgaagcactg tgctatcctg tggagggctt tggaccactg gagagaccaa gggtgctggg      2040
     aggaggcggc tgcacccacg agcaataaaa ttgatcccag ggttttcttg gttcttttgt      2100
//


spacer
spacer