spacer

EBI Dbfetch

ID   AK003649; SV 1; linear; mRNA; HTC; MUS; 1210 BP.
XX
AC   AK003649;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:1110013A05 product:1-ACYL-SN-GLYCEROL-3-PHOSPHATE
DE   ACYLTRANSFERASE EPSILON (EC 2.3.1.51) (1-AGP ACYLTRANSFERASE 5) (1-AGPAT 5)
DE   (LYSOPHOSPHATIDIC ACID ACYLTRANSFERASE-EPSILON) (LPAAT-EPSILON)
DE   (1-ACYLGLYCEROL-3-PHOSPHATE O-ACYLTRANSFERASE 5) homolog [Mus musculus],
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1210
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5d83328b56ffb52ddf3502a17594ea43.
DR   Ensembl-Gn; ENSMUSG00000031467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149565; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1110013A05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1210
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-day embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1110013A05"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             26..1123
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE
FT                   EPSILON (EC 2.3.1.51) (1-AGP ACYLTRANSFERASE 5) (1-AGPAT 5)
FT                   (LYSOPHOSPHATIDIC ACID ACYLTRANSFERASE-EPSILON)
FT                   (LPAAT-EPSILON) (1-ACYLGLYCEROL-3-PHOSPHATE
FT                   O-ACYLTRANSFERASE 5) homolog [Mus musculus]
FT                   (SWISSPROT|Q9D1E8, evidence: FASTY, 100%ID, 100%length,
FT                   match=1062)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1E8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="MGI:MGI:1196345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E8"
FT                   /protein_id="BAB22915.2"
FT                   /translation="MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPAR
FT                   LYQRVDDRLYCVYQNMVLFFFENYTGVQILLYGDLPKNKENVIYLANHQSTVDWIVADM
FT                   LAARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAG
FT                   TPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHL
FT                   DAIYDVTVVYEGNEKGSGKYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKKW
FT                   LHERFEIKDRLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTE
FT                   SGRKLYMGTWLYGTLLGCLWFVIKA"
FT   polyA_signal    1190..1195
FT                   /note="putative"
FT   polyA_site      1210
FT                   /note="putative"
XX
SQ   Sequence 1210 BP; 337 A; 263 C; 295 G; 315 T; 0 other;
     gagtcgcggc tggcgagccg agaggatgct gctgtccctg gtgctccaca cgtactctat        60
     gcgctacctg ctccccagcg tcctgttgct gggctcggcg cccacctacc tgctggcctg       120
     gacgctgtgg cgggtgctct ccgcgctgat gcccgcccgc ctgtaccagc gcgtggacga       180
     ccggctttac tgcgtctacc agaacatggt gctcttcttc ttcgagaact acaccggggt       240
     ccagatattg ctatatggag atttgccaaa aaataaagaa aatgtaatat atctagcgaa       300
     tcatcaaagc acagttgact ggattgttgc ggacatgctg gctgccagac aggatgccct       360
     aggacatgtg cgctacgtac tgaaagacaa gttaaaatgg cttccgctgt atgggttcta       420
     ctttgctcag catggaggaa tttatgtaaa acgaagtgcc aaatttaatg ataaagaaat       480
     gagaagcaag ctgcagagct atgtgaacgc aggaacaccg atgtatcttg tgattttccc       540
     agagggaaca aggtataatg caacatacac aaaactcctt tcagccagtc aggcatttgc       600
     tgctcagcgg ggccttgcag tattaaaaca cgtactgaca ccaagaataa aggccactca       660
     cgttgctttt gattctatga agagtcattt agatgcaatt tatgatgtca cagtggttta       720
     tgaagggaat gagaaaggtt caggaaaata ctcaaatcca ccatccatga ctgagtttct       780
     ctgcaaacag tgcccaaaac ttcatattca ctttgatcgt atagacagaa atgaagttcc       840
     agaggaacaa gaacacatga aaaagtggct tcatgagcgc tttgagataa aagataggtt       900
     gctcatagag ttctatgatt caccagatcc agaaagaaga aacaaatttc ctgggaaaag       960
     tgttcattcc agactaagtg tgaagaagac tttaccttca gtgttgatct tggggagttt      1020
     gactgctgtc atgctgatga cggagtccgg aaggaaactg tacatgggca cctggttgta      1080
     tggaaccctc cttggctgcc tgtggtttgt tattaaagca taagcaagta gcaggctgca      1140
     gtcacagtct cttattgatg gctacacgtt gtatcacatt gtttcctgaa ttaaataagg      1200
     attttcttgt                                                             1210
//


spacer
spacer