Dbfetch

ID   AK003331; SV 1; linear; mRNA; HTC; MUS; 735 BP.
XX
AC   AK003331;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:1110002O23 product:FK506 BINDING PROTEIN PRECURSOR homolog
DE   [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-735
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7426df0f479b0dbdc50bbbb30a50ba61.
DR   Ensembl-Gn; ENSMUSG00000003355; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003445; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1110002O23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..735
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-day embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1110002O23"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             115..720
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="FK506 BINDING PROTEIN PRECURSOR homolog [Homo
FT                   sapiens] (SPTR|Q9NYL4, evidence: FASTY, 90.5%ID,
FT                   100%length, match=603)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1M7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="MGI:MGI:1913370"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1M7"
FT                   /protein_id="BAB22719.1"
FT                   /translation="MTLSPLLLPLQLLLLLLFSGAVCRAEAGPETESPVRTLQVETLVQ
FT                   PPESCTESAAIGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMC
FT                   VGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVELIALIRANYWQKLLKSILPLVGIA
FT                   MVPALLGLIGYHLYRKASRPKVSKKKLKEEKRNKSKKK"
XX
SQ   Sequence 735 BP; 176 A; 199 C; 206 G; 154 T; 0 other;
     gagcgccttg aaaacccgcc cataccagtc tggcctggag tgagggaacc cgtcctggtc        60
     gcgtgcaccc gaacagcctg ccctggtatc ctggtgctct gacccggtcc aatcatgacc       120
     ctgagccctt tgctcctacc actccagctg ttactgctgc tactgttcag tggggcggtg       180
     tgccgggctg aggctgggcc agaaaccgaa agtcctgtcc ggaccctcca agtggagacc       240
     ctggtgcagc cccctgaatc gtgcacggaa tctgctgcca ttggagacac gctccacata       300
     cactacacgg gcagtttggt agatggacgc attattgaca cttctctgac cagagatcct       360
     ctggtcatag aactcggcca aaagcaggtg attccaggtc tggagcagag ccttttggac       420
     atgtgtgtgg gagagaagcg aagagcagtc attccttctc acctggctta tggaaagcga       480
     gggtacccgc catctatccc agccgatgca gtggtgcagt acgatgtgga gctgatcgct       540
     ttgattcgag ccaactactg gcagaagctg ctaaagagca ttttgcctct ggtaggcatc       600
     gccatggtgc cggcgctcct ggggctgatc gggtatcacc tgtacagaaa ggccagcaga       660
     cccaaagtct ccaaaaagaa gctaaaagag gagaaacgaa acaagagtaa gaagaaataa       720
     atagtggttt ttagc                                                        735
//