Dbfetch

ID   AK003230; SV 1; linear; mRNA; HTC; MUS; 1627 BP.
XX
AC   AK003230;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus 18-day embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:1110001J02 product:phosphatidylinositol 3-kinase, catalytic,
DE   beta polypeptide, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1627
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 31828ce35289d43e0bc90f50950c36a7.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1110001J02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1627
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-day embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1110001J02"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..958
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="phosphatidylinositol 3-kinase, catalytic, beta
FT                   polypeptide (MGD|MGI:1922019, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q9CTK7"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="MGI:MGI:1922019"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CTK7"
FT                   /protein_id="BAB22657.1"
FT                   /translation="EALSDLQSPLNPCVILSELYVEKCKYMDSKMKPLWLVYSSRAFGE
FT                   DSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVST
FT                   SETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCAGYCVASYVL
FT                   GIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTG
FT                   NTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKS
FT                   EEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS"
XX
SQ   Sequence 1627 BP; 421 A; 375 C; 387 G; 444 T; 0 other;
     tgaggcgctc tctgacctgc agtcgccgct gaacccctgc gtcatcctct cagagctcta        60
     tgttgaaaag tgcaaataca tggactccaa gatgaagccc ctgtggctgg tctacagcag       120
     cagagccttt ggagaggact cggttggagt gatctttaaa aatggtgacg atttgcggca       180
     ggacatgctg acgctgcaga tgttgcgcct gatggatctg ctttggaaag aagctggctt       240
     ggacctgcgg atgctcccct atggctgctt agcaacagga gatcgctctg gcctcattga       300
     ggttgtgagc acctctgaga caatcgctga cattcagctg aacagtagta acgtggctgc       360
     cacggcagcc ttcaacaaag acgcactcct gaactggctc aaggagtaca actctgggga       420
     tgacctggac cgagcgattg aggagtttac cttgtcctgt gctggctact gtgtagcctc       480
     ttatgtcctc ggcattggtg acaggcacag tgacaacatc atggtgaaga aaaccggcca       540
     gctcttccac atagattttg ggcatattct tggaaatttc aaatctaaat ttggcattaa       600
     aagggagcga gtacctttta ttcttactta tgacttcatt catgtcattc aacaaggaaa       660
     aacgggaaac actgaaaaat ttggcagatt ccgccagtgc tgtgaagatg cgtatctgat       720
     tttacggcgg catgggaatc tcttcatcac cctgtttgcc ctgatgttga ctgcagggct       780
     gcctgagctc acatcggtca aagatataca gtatcttaag gactcgcttg ccttagggaa       840
     gagcgaggag gaagcactga agcagttcaa gcagaagttt gacgaggccc tcagggaaag       900
     ctggactact aaagtgaact ggatggctca cacagtacgg aaagactaca ggtcctagcg       960
     tccgccctac tctgccgcac ttgcctgttc gtttcctttc cattttgcac ttgcactatt      1020
     gaacatgacc ctgccagaaa tgcaaaggga atgaaatcct gaagctcaga gtgaagttca      1080
     aaccacggcg tcccgcagag cctagtctga accaccccat gcccaccctg tgttcccgag      1140
     cgcttccagg actcatcgtg agcagcagca tggaggcccc ttcctgctga ccttgcacgc      1200
     gagggatgct actagggact gctggggatc ttttctttct ttccttcagt atttggtact      1260
     ttaccagaga ggtgtacata cttcttttca gtgttgtgac caagtgctgc gactcagcca      1320
     acaacttacc acattcgggg ctgggagctg ttctaagaaa gggacctccc tctccttttt      1380
     aaattggtga gccacaaatt acattgatta tgttgaactt attattcttc aaagaaaata      1440
     ttttaaacct gtgaaaactc actaattttg ttaatattta tcatgatggc atcatttcag      1500
     ccagactcgc tgagaatcta ttggtggggc aaatataata tatatataat atatatatat      1560
     atatatgctg catatatatt tataaaattt ctagtgggag ttctatataa aaagatgttt      1620
     ctttggt                                                                1627
//