Dbfetch

ID   AK002891; SV 1; linear; mRNA; HTC; MUS; 1831 BP.
XX
AC   AK002891;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610041O18 product:regulator of G-protein signaling 14, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1831
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b732c140fe012faa44fbaa501975348d.
DR   Ensembl-Gn; ENSMUSG00000052087; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020593; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020547; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020525; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020543; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020977; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019856; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020302; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020404; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020501; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020433; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021020; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019918; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000063771; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037180; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0037116; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0037085; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037134; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037588; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036832; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0036797; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036904; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037068; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036901; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0037643; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036299; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610041O18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1831
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610041O18"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             148..1293
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="regulator of G-protein signaling 14 (MGD|MGI:1859709
FT                   GB|NM_016758, evidence: BLASTN, 98%, match=1696)"
FT                   /db_xref="GOA:P97492"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="InterPro:IPR003116"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR030776"
FT                   /db_xref="MGI:MGI:1859709"
FT                   /db_xref="PDB:1WFY"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97492"
FT                   /protein_id="BAB22436.1"
FT                   /translation="MKFDSYARFVKSPLYQECLLAEAEGRPLREPGSSHLGSPDTARKP
FT                   KLKPGKSLPLGVEELGQLPLAEGPCGRPLRKSFRREMTGGAMNSALRRESQGSLNSSAS
FT                   LDLGFLAFVSSKSESHRKSLGSGESESESRPGKYCCVYLPDGTASLALARPGLTIRDML
FT                   AGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLENRITFQLELVGLERVV
FT                   RISAKPTKRLQEALQPILAKHGLSLDQVVLHRPGEKQPMDLENPVSSVASQTLVLDTPP
FT                   DAKMSEARSISPCRSQGCLPRTQTKDSHLPPSSSSLLVEDASSSTGNRQTCDIEGLVEL
FT                   LNRVQSSGAHDQRGLLRKEDLVLPEFLQLPSQRPGSREAPP"
XX
SQ   Sequence 1831 BP; 404 A; 511 C; 523 G; 393 T; 0 other;
     gagggcttgg ggtttccctg cttgaactgg ctagggcggg acctgggact ggagagatgc        60
     aggcagaacc caacatccag ccctccactg tcctctcctg gtaccaatca ccactcacac       120
     tcgctggcca agcagatctt caatttgatg aagttcgaca gctatgcgcg cttcgtcaaa       180
     tccccgctgt accaagagtg cctgctggcg gaggccgagg gacgccccct gcgggaacct       240
     ggctcctcac acctcgggag cccggacaca gcgaggaagc caaagctgaa gcctgggaag       300
     tcactgccgc tgggcgtgga agagttgggg cagctgccac tcgctgaggg cccttgtggc       360
     cgccctctcc gcaagtcctt tcgtagagag atgacaggtg gagccatgaa ttcggccctg       420
     cgacgagagt ctcaagggtc cctgaattct tctgccagtc tggacctggg tttccttgcc       480
     tttgtgagca gcaaatctga gagtcaccgg aagagccttg gaagtggaga gagtgagagc       540
     gagagtcggc cggggaagta ttgctgcgtg tatctacctg acggcacggc ttccttggcc       600
     ctggctcgac ctggcctcac catccgagac atgctggcag gcatctgtga gaagagaggc       660
     ctctctctgc ctgacattaa ggtctacctg gtgggcaatg aacagaaggc cctggtcctg       720
     gatcaggatt gcaccgtgct ggcagaccag gaagtgcgac tggaaaacag gatcaccttc       780
     cagctggagt tggtcggcct ggagcgagtg gtccggatct cagctaagcc cactaagcgt       840
     ctgcaagagg cgctgcagcc catcctggct aagcatggcc tgagcctgga ccaggtggta       900
     ctgcacaggc caggagagaa gcagcccatg gatttggaga atccagtgag ctcagtggcc       960
     tcacagacac tggttttgga cactcctccg gatgcaaaga tgagtgaagc cagaagcata      1020
     tccccctgcc gcagtcaggg atgcctccca agaacccaga ccaaggacag tcaccttccc      1080
     ccatcgtcct ccagtttgct ggtagaagat gccagtagtt ctactgggaa ccggcagacc      1140
     tgtgacattg aaggcctggt ggagctgctg aatcgggtgc agagcagcgg ggcccacgat      1200
     cagagaggac ttcttcgcaa agaggacctg gtccttccag aatttctgca gcttccttcc      1260
     caaagaccag gctctcggga ggctccacca tagactgaat caactattca gcccagggag      1320
     ggcccttcag actccaccac ccacccggtc ctctggcatc tgtgtaacaa tccaggctat      1380
     ctgcatggtg cctgggcaaa ccaagcatgc cacgggtctg tgctgcatgc cctatctgta      1440
     ccatgagtgt ctttggctcc tttctgctat gggcaggccc ccagaaaggg ccaggagggg      1500
     gtggctaact gttctctcat aggtttgcct acccattcct cccagtaggc catcaagagg      1560
     aggtgggcct agttccttgg cataagcata gtgaacacaa acgggtgact ttggcagtgc      1620
     cagcctcctc aacttgttct aggctttagc agggggcagg aaggaggggc tggcccctcc      1680
     ttaaagagtt gatataatat agacctggtg tactgtgaga acccctccct ccatccacaa      1740
     ctctacttac atatgatttt atggtggctt gggcagctgg tttgcctgat atatgtactg      1800
     tatataataa taataattat cattattatt c                                     1831
//