Dbfetch

ID   AK002879; SV 1; linear; mRNA; HTC; MUS; 872 BP.
XX
AC   AK002879;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610041C01 product:gamma-aminobutyric acid receptor associated
DE   protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-872
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f2884f96d3377980be9f6337b0e9ad67.
DR   Ensembl-Gn; ENSMUSG00000018567; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018575; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018543; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018512; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018515; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018328; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018966; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017883; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018300; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018410; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018400; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018480; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018423; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019008; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017657; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017937; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000018711; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0030169; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030108; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030082; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030101; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0029897; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0030603; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0029597; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0029814; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029952; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0029943; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030067; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0029927; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0030631; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0029314; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0029389; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610041C01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..872
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610041C01"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             99..452
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="gamma-aminobutyric acid receptor associated protein
FT                   (MGD|MGI:1861742)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9DCD6"
FT                   /db_xref="InterPro:IPR004241"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1861742"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCD6"
FT                   /protein_id="BAB22426.1"
FT                   /translation="MKFVYKEEHPFDKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLD
FT                   KKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFF
FT                   LYIAYSDESVYGL"
FT   regulatory      849..854
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      872
FT                   /note="putative"
XX
SQ   Sequence 872 BP; 195 A; 246 C; 202 G; 229 T; 0 other;
     aagtctgttc gtcgaagccg cctccgccgc cgccccctgt cccggccccc cccctgggtt        60
     ccctcagccc agctcggtcc agcccggttc tcgggagaat gaagttcgtg tacaaagagg       120
     agcatccgtt cgacaagcgc cgctctgagg gcgagaaaat ccgaaagaaa tacccagacc       180
     gggtcccggt gatagtggaa aaagccccca aagctcggat aggagacctg gacaaaaaga       240
     aatacctggt gccttctgat cttacagttg gtcaattcta cttcttgatc cggaagcgaa       300
     ttcatctccg tgctgaagat gccttgtttt tctttgtcaa caatgtcatt ccacccacca       360
     gtgccacgat gggtcagctg taccaggaac accatgaaga agacttcttt ctatacattg       420
     cctacagtga tgaaagcgtc tatggtctgt gaagctgctg tacctgaggt ggggggttcc       480
     attctacgaa gagaggtggc gctccttcct tgacatccag ttcctccttc aggctcaaac       540
     accacctcct ttcttcagga cctgcactta atgtttgagg ctgtctctcc agtccctctc       600
     agcaggaggg gtaatggtag atacagcctc catacatctc tttctcccct tgtttaccct       660
     ccattcccac tctgatttag acttcttgat tgtcgatctc tgtcacatcc gatgattgtt       720
     ttggtttcta ttccctttct aactgcccat cgggctcaga accccaataa tcccttcctt       780
     tcactatctt ctttttgggg ggtaggtgga agggattgac attggatggg ggaggtagga       840
     ggcacatcaa taaaaaggaa accaccgagc tc                                     872
//