spacer

EBI Dbfetch

ID   AK002734; SV 1; linear; mRNA; HTC; MUS; 1403 BP.
XX
AC   AK002734;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610033B02 product:N-acetylneuraminate pyruvate lyase, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1403
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 206f8a46bdcc35296de2e0951ccd5bed.
DR   Ensembl-Gn; ENSMUSG00000042684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041874; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610033B02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1403
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610033B02"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             84..1046
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="N-acetylneuraminate pyruvate lyase
FT                   (MGD|MGI:1921341)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9DCJ9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="MGI:MGI:1921341"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCJ9"
FT                   /protein_id="BAB22314.1"
FT                   /translation="MAFPKKKLRGLVAATITPMTENGEINFPVIGQYVDYLVKEQGVKN
FT                   IFVNGTTGEGLSLSVSERRQVAEEWVNQGRNKLDQVVIHVGALNVKESQELAQHAAEIG
FT                   ADGIAVIAPFFFKSQNKDALISFLREVAAAAPTLPFYYYHMPSMTGVKIRAEELLDGIQ
FT                   DKIPTFQGLKFTDTDLLDFGQCVDQNHQRQFALLFGVDEQLLSALVMGATGAVGSTYNY
FT                   LGKKTNQMLEAFEQKDLASALSYQFRIQRFINYVIKLGFGVSQTKAIMTLVSGIPMGPP
FT                   RLPLQKATQEFTAKAEAKLKSLDFLSSPSVKEGKPLASA"
FT   polyA_signal    1380..1385
FT                   /note="putative"
FT   polyA_site      1403
FT                   /note="putative"
XX
SQ   Sequence 1403 BP; 390 A; 306 C; 333 G; 374 T; 0 other;
     agatcgcgtc tccagtgcac agcagcctag gtgagcgcgg cgccaccgag cagaggagtg        60
     aagtcagacc ttccagcaac ccgatggcct tccctaagaa gaaactccgg ggtcttgttg       120
     ctgccaccat cactccaatg acagagaatg gagaaatcaa ctttcctgtc attggtcagt       180
     atgtggatta cctggtgaag gaacaggggg tgaagaatat ttttgtgaat ggcaccacag       240
     gagaaggcct gtccctgagc gtctctgaac gtcgccaggt cgcggaggaa tgggttaacc       300
     aagggaggaa caagttggac caggtggtga ttcacgtggg agcactaaac gtgaaggagt       360
     cacaagaact ggcccaacat gcagcagaaa ttggagctga tggcattgct gtcattgcgc       420
     ctttcttttt caagtcacag aacaaagatg ccctgataag cttcctgaga gaggtggcag       480
     ccgcagctcc tactttgcca ttttattact accacatgcc ttccatgacc ggggtaaaga       540
     ttcgcgctga ggagctgctg gacgggattc aggacaagat ccccaccttc caaggactga       600
     agttcaccga cacggacctc ttggatttcg gccaatgtgt cgatcagaat caccagcgac       660
     agtttgcttt gctctttggg gtggacgaac aactgctgag tgctctggtc atgggagcca       720
     ctggagcagt aggcagtacc tataactacc tgggaaaaaa gacaaaccag atgttggaag       780
     cttttgaaca gaaggacttg gcttcagcgc tcagttacca gtttcgtatc cagagattta       840
     tcaactatgt gatcaagcta ggttttggag tgtcgcaaac caaagccatc atgacgctgg       900
     tctctgggat tccaatgggc ccaccccggc ttcctctgca gaaagccacc caggagttta       960
     ctgctaaggc tgaggccaag ctaaagagcc tggatttcct ttcttcccct agtgtaaagg      1020
     aggggaagcc tttagctagt gcctgataag tctgggtgtg taagcttaga cttatctatc      1080
     ttcaatagta cattcttttc tcagggactt ttttaggtga atttgaaccc atctttattt      1140
     taggaagtag aatcccacac caatcaaata ttgattatga acctaaactt ttttgttata      1200
     aaggagtcac aagctctaag tcattcattt tgtaaaatta ttatagagaa atctctactt      1260
     atacagatgc aatggaacca agtgaaaatt gtaatagtaa ttacaattat taattaatta      1320
     cattaattaa tataattcat atcactatat taattgctac attggttata ttattgctga      1380
     ataaatttca cctgcctttt ggg                                              1403
//


spacer
spacer