Dbfetch

ID   AK002721; SV 1; linear; mRNA; HTC; MUS; 552 BP.
XX
AC   AK002721;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610031F03 product:S100 calcium binding protein A1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-552
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d775464daec71cc2d374dae1735f44b2.
DR   Ensembl-Gn; ENSMUSG00000044080; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027468; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027432; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027397; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027441; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027183; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027887; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026629; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027158; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027295; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027263; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027404; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027284; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027946; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026363; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026711; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000060738; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062070; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0062106; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0062035; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062030; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061731; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062519; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062016; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0061695; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0061797; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0061768; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0061937; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061752; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062711; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061570; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060985; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610031F03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..552
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610031F03"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             85..369
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="S100 calcium binding protein A1 (MGD|MGI:1338917
FT                   GB|NM_011309, evidence: BLASTN, 99%, match=479)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q91V77"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028486"
FT                   /db_xref="MGI:MGI:1338917"
FT                   /db_xref="UniProtKB/TrEMBL:Q91V77"
FT                   /protein_id="BAB22308.1"
FT                   /translation="MGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGF
FT                   LDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS"
FT   regulatory      532..537
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      552
FT                   /note="putative"
XX
SQ   Sequence 552 BP; 128 A; 146 C; 145 G; 133 T; 0 other;
     gggtccagtg gccacatttg cagcgtgccc ttctgtcgag aatctgttcc gacgtcaggc        60
     cgaggccaac cgtgtgctgc tgaaatgggc tctgagctgg agagtgccat ggagaccctc       120
     atcaatgtgt tccatgccca ttcgggcaag gaaggggaca aatataagct gagcaagaaa       180
     gaactgaaag acctgctaca aactgaactt tctggcttcc tggatgtcca gaaggatgca       240
     gatgctgtgg acaaggtaat gaaggaactg gatgaaaacg gagatgggga agtggacttc       300
     aaggagtatg ttgtgctggt ggctgctctc acagtggctt gtaacaactt cttctgggag       360
     accagttgag cacagtctgt gagcagtgcc cttcctctcc cacttgtcaa gatttcccct       420
     ttagcgtgct tgctcctcac cccacctgta cctccctatg tccccatcct tgcccagtct       480
     cgacgtgcac caagggcaca agagtggcag tccagatctg ccacttgttt taataaagcc       540
     ttctctctca cc                                                           552
//