spacer

EBI Dbfetch

ID   AK002714; SV 1; linear; mRNA; HTC; MUS; 997 BP.
XX
AC   AK002714;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610030O24 product:prohibitin, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-997
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f8e0ec05e2e9a4baf904c28e3de27f2b.
DR   Ensembl-Gn; ENSMUSG00000038845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125172; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610030O24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..997
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610030O24"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             60..878
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="prohibitin (MGD|MGI:97572, evidence: Direct
FT                   assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:P67778"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="MGI:MGI:97572"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67778"
FT                   /protein_id="BAB22305.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
FT   regulatory      980..985
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      997
FT                   /note="putative"
XX
SQ   Sequence 997 BP; 239 A; 254 C; 288 G; 216 T; 0 other;
     gggaattcat gtggaggtca gagtgtaagc aggtgtgagt ggaagcaaca gaatgagtca        60
     tggctgccaa agtgtttgag tccattggaa agttcggcct ggcgttggca gttgcaggag       120
     gcgtggtgaa ctctgctttg tataatgtgg atgctggaca cagagctgtc atctttgacc       180
     gattccgtgg cgtacaggac attgtggtcg gggaagggac tcatttcctc atcccttggg       240
     tacagaaacc aattatcttt gactgccgct ctcgaccacg gaacgtacca gtcatcactg       300
     gtagcaaaga cttgcagaac gtcaatatca cactgcgaat cctcttccgg ccggtggcca       360
     gccagcttcc tcgtatctac accagcattg gcgaggacta tgatgagcgg gtcctgcctt       420
     ctatcaccac agagatcctc aagtcggtgg tggctcgatt cgatgctgga gaattgatta       480
     cccagcgaga gctggtctcc aggcaggtga gcgatgacct cacagagcga gcggcaacat       540
     ttgggcttat cctggatgac gtgtccctga cacatctgac cttcgggaag gagttcacag       600
     aggcagtaga agccaaacag gtggctcagc aggaagcgga gagagccaga tttgtggtgg       660
     aaaaggctga gcagcagaag aaggcagcca tcatctctgc tgagggtgac tccaaggccg       720
     ctgagctgat cgccaactcg ctggccacgg caggcgacgg cctgatcgag ctgcggaagc       780
     tggaggccgc cgaggacatt gcgtaccagc tctcccgctc tcggaacatc acctacctgc       840
     cagcgggcca gtccgtgctt ctccagcttc cccagtgagg ccagccgggc cacggcctcc       900
     atcatgctga atgacgcctt ccttttgccc cacccaagaa aatcattttg aaatttcatg       960
     attggtttaa agtgaaggaa ataaaggtaa aataaat                                997
//


spacer
spacer