spacer

EBI Dbfetch

ID   AK002642; SV 1; linear; mRNA; HTC; MUS; 1946 BP.
XX
AC   AK002642;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610016O20 product:aminolevulinic acid synthase 2, erythroid, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1946
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f6e22d8eb33de86cefe8a1d8210a68d9.
DR   Ensembl-Gn; ENSMUSG00000025270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066337; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610016O20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1946
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610016O20"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             56..1819
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="aminolevulinic acid synthase 2, erythroid
FT                   (MGD|MGI:87990)"
FT                   /note="putative"
FT                   /db_xref="GOA:P08680"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015118"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="MGI:MGI:87990"
FT                   /db_xref="PDB:1H7D"
FT                   /db_xref="PDB:1H7J"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08680"
FT                   /protein_id="BAB22254.1"
FT                   /translation="MVAAAMLLRSCPVLSQGPTGLLGKVAKTYQFLFSIGRCPILATQG
FT                   PTCSQIHLKATKAGGDSPSWRKSHCPFMLSELQDRKSKIVQRAAPEVQEDVKTFKTDLL
FT                   STMDSTTRSHSFPSFQEPEQTEGAVPHLIQNNMTGSQAFGYDQFFRDKIMEKKQDHTYR
FT                   VFKTVNRWANAYPFAQHFSEASMASKDVSVWCSNDYLGISRHPRVLQAIEETLKNHGAG
FT                   AGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYSD
FT                   AGNHASMIQGIRNSGAAKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMDGAICPL
FT                   EELCDVAHQYGALTFVDEVHAVGLYGARGAGIGERDGIMHKLDIISGTLGKAFGCVGGY
FT                   IASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMR
FT                   QLLMDRGFPVIPCPSHIIPIRVGNAALNSKICDLLLSKHSIYVQAINYPTVPRGEELLR
FT                   LAPSPHHSPQMMENFVEKLLLAWTEVGLPLQDVSVAACNFCHRPVHFELMSEWERSYFG
FT                   NMGPQYVTTYA"
FT   polyA_signal    1924..1929
FT                   /note="putative"
FT   polyA_site      1946
FT                   /note="putative"
XX
SQ   Sequence 1946 BP; 450 A; 527 C; 496 G; 473 T; 0 other;
     gactcaccgt ctttggttcg tcctcagtgc agggcaacag gactttgggc tcaggatggt        60
     ggcagcagct atgttgctac ggtcctgtcc agtgctctct cagggcccca caggcctcct       120
     gggcaaagtg gctaaaacct accagttcct atttagtatt ggacgctgcc ccatcctggc       180
     cactcaagga ccaacctgtt ctcaaatcca tcttaaggca accaaggctg gaggagactc       240
     tccatcttgg agaaagagcc attgtccttt catgctgtca gaactccaag acaggaagag       300
     caagattgtg cagagggcag ctccagaagt tcaagaggat gtcaagactt tcaagacaga       360
     cctgctgagc accatggatt caaccacccg aagccattca tttcctagtt tccaggagcc       420
     agagcagact gaaggggcag ttccccacct gattcagaac aatatgactg gaagccaggc       480
     tttcggttat gaccaatttt tcagagacaa gatcatggag aagaaacagg accacaccta       540
     ccgtgtgttc aagactgtga atcgttgggc taatgcctac ccctttgccc aacacttctc       600
     cgaggcatct atggcatcaa aggatgtttc tgtttggtgt agtaatgact atttgggcat       660
     aagcagacac cctcgtgtct tgcaggccat agaggagacc ctgaagaatc atggagctgg       720
     agctgggggc actcgcaata tctcaggtac cagcaagttt catgtggagc ttgaacagga       780
     gctggctgaa ctacaccaga aagactcagc tctgctcttc tcctcctgtt ttgtggccaa       840
     tgattctact ctctttacac tggccaagct tctgccaggg tgtgagatct actcagatgc       900
     aggcaatcat gcctccatga tccaaggcat tcgcaacagt ggtgcagcca agtttgtctt       960
     cagacacaat gacccaggcc acctgaagaa acttctcgag aagtctgatc ccaagacacc      1020
     aaaaattgtg gcttttgaga ctgttcattc catggatggt gccatctgtc ctctggagga      1080
     attgtgtgat gtggcccacc agtatggagc cctgaccttc gtagatgaag tccatgctgt      1140
     aggactgtat ggagcccggg gtgcaggtat cggggagcgt gatggaatta tgcacaagct      1200
     tgacatcatc tctggaactc ttggcaaggc ctttggttgc gtcggtggct atatagccag      1260
     cactcgggac ttggtggaca tggtgcgctc ctacgctgca ggcttcatct ttaccacttc      1320
     actgcctccc atggtgctct ctggggctct agaatctgtg cgcctactca agggagagga      1380
     gggtcaagcc ctgaggcggg cacaccagcg caatgtcaaa cacatgcgcc agctgctaat      1440
     ggacaggggc tttcctgtta tcccctgtcc cagccacatc atccccatca gggtgggtaa      1500
     tgcagcactc aacagcaaga tctgtgatct tctgctctcc aagcacagca tctatgtgca      1560
     ggccatcaac tacccaactg tgcctcgtgg tgaggagcta ctgcgcttgg ccccctcccc      1620
     ccaccacagc cctcagatga tggaaaactt tgtggagaag ctgctgctgg cctggactga      1680
     ggtggggctg cccctccaag atgtgtctgt ggctgcatgc aacttctgtc atcgtcctgt      1740
     gcactttgaa cttatgagcg agtgggagcg atcctacttt gggaacatgg gaccccaata      1800
     tgttaccacc tatgcttaag gagccagctg ccttggatgc cagctccacc tgcactcccc      1860
     ctggggctgg gcttcctcct gctctctgct ttcctgtgtg cttctggctg acttgattct      1920
     gaaaataaag agcaacttga aacatt                                           1946
//


spacer
spacer