Dbfetch

ID   AK002590; SV 1; linear; mRNA; HTC; MUS; 1437 BP.
XX
AC   AK002590;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610012D23 product:tumor necrosis factor receptor superfamily, member
DE   6, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1437
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c954d33b17e34637921881525f8daf0e.
DR   Ensembl-Gn; ENSMUSG00000024778; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025056; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025034; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025000; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025030; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024789; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025471; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024766; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024898; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024859; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024984; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024890; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025529; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024323; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025691; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0051587; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0051530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051529; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051260; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052016; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051395; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0051202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0051307; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0051262; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0051426; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051259; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052145; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050544; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610012D23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1437
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610012D23"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             8..991
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="tumor necrosis factor receptor superfamily, member 6
FT                   (MGD|MGI:95484 GB|NM_007987, evidence: BLASTN, 99%,
FT                   match=1436)"
FT                   /db_xref="GOA:P25446"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR008063"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR033998"
FT                   /db_xref="InterPro:IPR033999"
FT                   /db_xref="MGI:MGI:95484"
FT                   /db_xref="PDB:2NA6"
FT                   /db_xref="PDB:3OQ9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25446"
FT                   /protein_id="BAB22211.1"
FT                   /translation="MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCS
FT                   EGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCD
FT                   EEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRK
FT                   QSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLS
FT                   KYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSD
FT                   AYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE"
FT   regulatory      1413..1418
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1437
FT                   /note="putative"
XX
SQ   Sequence 1437 BP; 463 A; 291 C; 323 G; 360 T; 0 other;
     ggcagacatg ctgtggatct gggctgtcct gcctctggtg cttgctggct cacagttaag        60
     agttcatact caaggtacta atagcatctc cgagagttta aagctgagga ggcgggttcg       120
     tgaaactgat aaaaactgct cagaaggatt atatcaagga ggcccatttt gctgtcaacc       180
     atgccaacct ggtaaaaaaa aagttgagga ctgcaaaatg aatgggggta caccaacctg       240
     cgccccatgc acagaaggga aggagtacat ggacaagaac cattatgctg ataaatgcag       300
     aagatgcaca ctctgcgatg aagagcatgg tttagaggtg gaaacaaact gcaccctgac       360
     ccagaatacc aagtgcaagt gcaaaccaga cttctactgc gattctcctg gctgtgaaca       420
     ctgtgttcgc tgcgcctcgt gtgaacatgg aacccttgag ccgtgcacag caaccagcaa       480
     tacaaactgc aggaaacaaa gtcccagaaa tcgcctatgg ttgttgacca tccttgtttt       540
     gttaattcca cttgtattta tatatcgaaa gtaccggaaa agaaagtgct ggaaaaggag       600
     acaggatgac cctgaatcta gaacctccag tcgtgaaacc ataccaatga atgcctcaaa       660
     tcttagcttg agtaaataca tcccgagaat tgctgaagac atgacaatcc aggaagctaa       720
     aaaatttgct cgagaaaata acatcaagga gggcaagata gatgagatca tgcatgacag       780
     catccaagac acagctgagc agaaagtcca gctgctcctg tgctggtacc aatctcatgg       840
     gaagagtgat gcatatcaag atttaatcaa gggtctcaaa aaagccgaat gtcgcagaac       900
     cttagataaa tttcaggaca tggtccagaa ggaccttgga aaatcaaccc cagacactgg       960
     aaatgaaaat gaaggacaat gtctggagtg aaaactacct cagttccagc catgaagaga      1020
     ggagagagcc tgccacccat gatggaaaca aaatgaatgc caactgtatt gacattggca      1080
     actcctggtg tgttctcttt gccagcaaat ggtagttgat actcagtgag ggtcaaatga      1140
     ctagcaggtt ccagggactg cttctgttat tctctgcagt tgctgagatg aaccattttc      1200
     tctgtctact gcaattttta cattcaaatg tccatgaaat ttgtattaaa tgtgaagtgg      1260
     aatctgcagt gtttgtgttt atattcatat actatgaact gaggagaatt ataaactgaa      1320
     acaaatactc gcagttaatt gaagaccttc cattgatgga cagttctttt cctctctatg      1380
     tggaaatgta taatagaaga aataattttt aaattaaagt atctcttttt gcatttc         1437
//