spacer

EBI Dbfetch

ID   AK002440; SV 1; linear; mRNA; HTC; MUS; 596 BP.
XX
AC   AK002440;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610010A16 product:UNCHARACTERIZED HEMATOPOIETIC STEM/PROGENITOR
DE   CELLS PROTEIN MDS033 homolog [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-596
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d7dba4e431b7563038cd03a746e79fd3.
DR   Ensembl-Gn; ENSMUSG00000036835; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043898; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610010A16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..596
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610010A16"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             164..469
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UNCHARACTERIZED HEMATOPOIETIC STEM/PROGENITOR CELLS
FT                   PROTEIN MDS033 homolog [Homo sapiens] (SPTR|Q9NZ42,
FT                   evidence: FASTY, 96%ID, 100%length, match=303)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9CQR7"
FT                   /db_xref="InterPro:IPR019379"
FT                   /db_xref="MGI:MGI:1913590"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQR7"
FT                   /protein_id="BAB22102.1"
FT                   /translation="MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLAP
FT                   AYTEQSQIKGYVWRSAVGFLFWVIILATWITIFQIYRPRWGALGDYLSFTIPLGTP"
FT   polyA_signal    578..583
FT                   /note="putative"
FT   polyA_site      596
FT                   /note="putative"
XX
SQ   Sequence 596 BP; 122 A; 178 C; 136 G; 160 T; 0 other;
     gaaacaaact ccactgaaaa ctgcggcatc tcccgcaaat ctcccgcaaa ggaatccagg        60
     cagaagggat aaaccgcact ggggcgtggt tgctcgtgat cttgcgtctg tcatttgggt       120
     cttgctctgc agacccttag gaccaccggg ctccagcgca actatgaact tggagcgggt       180
     atccaatgag gagaagttga acctgtgccg gaagtactat cttggtggat ttgcgttcct       240
     gccttttctt tggttagtca acattttctg gttcttcaga gaggcgttcc tcgccccagc       300
     ctacacagag cagagccaaa tcaaaggcta tgtttggcgc tcagctgtgg gcttcctctt       360
     ctgggtgatc attctcgcca cctggatcac catcttccag atctaccggc cccgctgggg       420
     cgctcttggg gactacctct ccttcaccat tcccctgggc actccctaac aacttcataa       480
     gctgctgatc tgttctttct cccaggatga aggcttctct gctctaggct ttccctcaga       540
     ccctgaagac atctgtttct catttcccat ctgccccaat aaaggaccct aacttt           596
//


spacer
spacer