spacer

EBI Dbfetch

ID   AK002423; SV 1; linear; mRNA; HTC; MUS; 1422 BP.
XX
AC   AK002423;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610009M21 product:AMINOACYLASE-1 (EC 3.5.1.14) (N-ACYL-L-AMINO-ACID
DE   AMIDOHYDROLASE) (ACY-1) homolog [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1422
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000023262; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024031; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610009M21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1422
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610009M21"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             106..1332
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="AMINOACYLASE-1 (EC 3.5.1.14) (N-ACYL-L-AMINO-ACID
FT                   AMIDOHYDROLASE) (ACY-1) homolog [Homo sapiens]
FT                   (SWISSPROT|Q03154, evidence: FASTY, 85.3%ID, 100%length,
FT                   match=1224)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q99JW2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010159"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="MGI:MGI:87913"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99JW2"
FT                   /protein_id="BAB22090.1"
FT                   /translation="MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQL
FT                   GLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEG
FT                   YIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPE
FT                   FQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKLHKV
FT                   ISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDV
FT                   DMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEP
FT                   EIFPAATDSRFIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALA
FT                   SVPTLPSES"
FT   polyA_signal    1401..1406
FT                   /note="putative"
FT   polyA_site      1422
FT                   /note="putative"
XX
SQ   Sequence 1422 BP; 318 A; 392 C; 409 G; 303 T; 0 other;
     cgttttgaga ttgggagcga cctcggtgga ccctgagttc cggccacagt ctgagaggaa        60
     agcacaggac tgagacgtgg agagagcaag ccagcacgcg gcgccatgac caccaaggat       120
     cccgagtctg agcacccctc cgtgacgctc ttccgccagt acctgcgcat ctgcactgtg       180
     caacccaatc cagactatgg aggggccatc accttcctgg aggagagagc ccgccagctg       240
     ggtctgagct gtcagaaaat agaggtggtg cctggctttg tgatcactgt gctgacctgg       300
     ccaggcacca acccgtcact cccctccatc ttgctaaact cccacacaga tgtggtacct       360
     gtcttcaagg aacattggca tcacgacccc tttgaggcct tcaaggattc cgagggctac       420
     atctatgcta ggggctccca ggacatgaag agtgtcagca tccagtacct ggaagctgtg       480
     aggaggctga agagcgaggg ccaccgattc cctaggacca tccacatgac ctttgtgcct       540
     gacgaggagg tcggaggtca caaggggatg gagttgtttg tgaagaggcc tgagttccag       600
     gctctgcggg caggcttcgt tctggacgag ggcctggcca accccacgga tgcctttact       660
     gtcttttata gtgagcggag tccttggtgg gtacaggtta ccagcactgg gaagccaggc       720
     catgcctcac gcttcattga ggatacagct gcagagaagt tgcataaggt tataagctcc       780
     atcttggcat tccgggagaa ggaaaggcag aggctgcagg cgaaccctca cctgaaggaa       840
     ggcgccgtga cttcggtgaa tctgaccaag cttgaaggtg gcgtggccta taatgtggta       900
     cctgccacta tgagtgccag ctttgacttc cgagtggcac cagatgtaga catgaaggcc       960
     ttcgagaagc agctgcagag atggtgccag gaagcaggag agggggtcac ctttgagttt      1020
     gctcagaagt ttacagagcc tcgaatgaca cccacggatg attcagatcc ctggtgggca      1080
     gctttcagcg gagcctgcaa ggcaatgaac ctcactctgg agccagagat ctttcctgct      1140
     gccactgaca gccgctttat ccgggcggtg gggatcccag ctctgggctt ctcgcccatg      1200
     aaccgcacac ctgtcctgct acatgaccat aatgaacggc tgcatgagga tatatttctc      1260
     cgtggggttg acatatatac aggcctcctc tctgcacttg ctagtgtgcc caccctgcct      1320
     agtgaaagct gagccccagg gcttccaact cttgtactct cagtcctacc actgccaagg      1380
     atctgtttcc cctgcccagt aataaagcca gcattggatg gg                         1422
//


spacer
spacer