spacer

EBI Dbfetch

ID   AK002418; SV 1; linear; mRNA; HTC; MUS; 2281 BP.
XX
AC   AK002418;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610009K21 product:ceroid-lipofuscinosis, neuronal 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2281
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 081ecf35ee25e91a984a675b33e3b4f9.
DR   Ensembl-Gn; ENSMUSG00000030894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033184; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610009K21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2281
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610009K21"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             40..1728
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="ceroid-lipofuscinosis, neuronal 2 (MGD|MGI:1336194)"
FT                   /note="putative"
FT                   /db_xref="GOA:O89023"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="MGI:MGI:1336194"
FT                   /db_xref="UniProtKB/Swiss-Prot:O89023"
FT                   /protein_id="BAB22085.1"
FT                   /translation="MGLQARLLGLLALVIAGKCTYNPEPDQRWMLPPGWVSLGRVDPEE
FT                   ELSLTFALKQRNLERLSELVQAVSDPSSPQYGKYLTLEDVAELVQPSPLTLLTVQKWLS
FT                   AAGARNCDSVTTQDFLTCWLSVRQAELLLPGAEFHRYVGGPTKTHVIRSPHPYQLPQAL
FT                   APHVDFVGGLHRFPPSSPRQRPEPQQVGTVSLHLGVTPSVLRQRYNLTAKDVGSGTTNN
FT                   SQACAQFLEQYFHNSDLTEFMRLFGGSFTHQASVAKVVGKQGRGRAGIEASLDVEYLMS
FT                   AGANISTWVYSSPGRHEAQEPFLQWLLLLSNESSLPHVHTVSYGDDEDSLSSIYIQRVN
FT                   TEFMKAAARGLTLLFASGDTGAGCWSVSGRHKFRPSFPASSPYVTTVGGTSFKNPFLIT
FT                   DEVVDYISGGGFSNVFPRPPYQEEAVAQFLKSSSHLPPSSYFNASGRAYPDVAALSDGY
FT                   WVVSNMVPIPWVSGTSASTPVFGGILSLINEHRILNGRPPLGFLNPRLYQQHGTGLFDV
FT                   THGCHESCLNEEVEGQGFCSGPGWDPVTGWGTPNFPALLKTLLNP"
XX
SQ   Sequence 2281 BP; 508 A; 659 C; 531 G; 583 T; 0 other;
     ggacttatca catgactaca gatcagcctg aaagccaaaa tgggactcca agcccgcctc        60
     ctagggctcc ttgctctcgt catcgccggc aaatgcactt acaaccctga gccggaccag       120
     cggtggatgc tgcctccagg ctgggtgtcc ctgggccgcg tggatcccga ggaagagctg       180
     agtctcactt ttgcgctgaa acagcggaac ctggaaagac tctcggagct ggtgcaggct       240
     gtgtcggatc ctagctctcc tcaatatgga aagtacctaa ccctggagga tgtagctgag       300
     ctggttcaac catcacccct gaccctcctc actgtccaaa agtggctctc agcagctgga       360
     gcccggaact gcgattcagt gaccacccag gactttctga cttgctggct gagtgtccga       420
     caggctgagc tgctgctccc aggagctgag tttcatcgct atgtaggggg acctacaaag       480
     acccatgtta taaggtcccc acatccctac cagcttcccc aggccttggc ccctcatgtg       540
     gattttgtgg gggggctgca ccgtttcccc ccttcatctc caagacaacg tccagaacca       600
     caacaggtag gaactgttag cctgcacttg ggagtgactc cgtctgtgct ccgtcagcga       660
     tacaacctga cagccaaaga tgtgggctca ggcaccacca acaatagcca ggcctgtgcc       720
     cagttcctgg aacagtactt ccataactcg gatctgactg agttcatgcg cctattcggt       780
     ggcagtttta cacaccaggc ctcagtagca aaagttgttg gaaagcaagg gcgaggccga       840
     gctgggatcg aggccagtct agatgtggaa tacctgatga gtgctggtgc caatatctcc       900
     acttgggtct acagtagccc tggccgccat gaggcacagg agcccttctt acaatggctc       960
     ctgcttctta gcaatgagtc atctttgcca catgtacata ctgtgagtta cggagacgat      1020
     gaagactccc tcagcagcat ctacatccag agagtcaaca ctgagttcat gaaggctgct      1080
     gctcggggtc tcaccctcct ttttgcctca ggtgacactg gagctgggtg ttggtctgtc      1140
     tccggaagac acaagttccg ccctagcttc cctgcttcca gcccctatgt tactacagtt      1200
     ggaggaacct ccttcaagaa tcctttcctc atcacagatg aagtagttga ctatatcagt      1260
     ggtggaggct tcagcaatgt tttcccacgg cctccctacc aggaggaagc agtggcccag      1320
     ttcttgaaat ccagctctca tctaccacca tccagttact tcaatgctag tggccgtgcc      1380
     tacccagatg ttgccgcact atctgatggc tactgggtgg tcagcaacat ggtccccatt      1440
     ccatgggtat ctggaacctc ggcctctact ccagtgtttg ggggaatttt atccttgata      1500
     aatgagcaca gaatcctcaa tggccgccct cctcttggct ttctcaaccc caggctctat      1560
     cagcagcatg ggacaggact ctttgatgta acccacggct gccatgagtc ctgtctgaat      1620
     gaagaagtgg agggtcaggg tttctgctct ggtcctggct gggatcctgt gacaggttgg      1680
     ggaacaccca acttcccagc cctactgaag accctgctca acccttgacc ctttcgtgcc      1740
     atgacgagaa agcagaactg ttccctgtac taaaagggaa ggctcagttt cttgttattc      1800
     ctcgatagaa gccctgctga actcctgttg cctgctgcag atagcttctc cctaaccctc      1860
     agatgctgtg aacaggactc aactctcaat cctactgtgt gccatcaaac tcaggtctcc      1920
     aaacttctac ttcaagatcc tcaacaagat gctataacca gcatattttg tctcacccca      1980
     accccatctc tccttcctct ttccagcttg agatgtgaaa gcagggcaag aaggttcagt      2040
     cttccattac tgacactagc aggtccaccc aacgcttacc acctctgcac tgaccgtaca      2100
     ctctatttct cttcgggttt gcttttccgt tcactgaagt gagacctttg actaatcgtt      2160
     ttgtctttct tctctcggca ctgaagtaca atggtctccc caatgtttta tccagttata      2220
     cccttttcag tgtttgtttt atgggttttc ttatttaaga acaggttgtc aaaaaaccat      2280
     t                                                                      2281
//


spacer
spacer