spacer

EBI Dbfetch

ID   AK002401; SV 1; linear; mRNA; HTC; MUS; 1523 BP.
XX
AC   AK002401;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610009H21 product:alpha-methylacyl-CoA racemase, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1523
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; db45362657a9d2d92518ee8eaeb579bb.
DR   Ensembl-Gn; ENSMUSG00000022244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070877; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610009H21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1523
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610009H21"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             23..1168
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="alpha-methylacyl-CoA racemase (MGD|MGI:1098273)"
FT                   /note="putative"
FT                   /db_xref="GOA:O09174"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="MGI:MGI:1098273"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09174"
FT                   /protein_id="BAB22072.2"
FT                   /translation="MVLRGVRVVELAGLAPGPFCGMVLADFGAEVVRVNRLGSTGENFL
FT                   ARGKRSLALDLKRSQGVTVLRRMCARADVLLEPFRCGVMEKLQLGPETLLQDNPKLIYA
FT                   RLSGFGQSGIFSKVAGHDINYLALSGVLSKIGRSGENPYPPLNLLADFGGGGLMCTLGI
FT                   VLALFERTRSGRGQVIDSSMVEGTAYLSSFLWKTQPMGLWKQPRGQNILDGGAPFYTTY
FT                   KTADGEFMAVGAIEPQFYALLLKGLGLESEELPSQMSSADWPEMKKKFADVFAKKTKAE
FT                   WCQIFDGTDACVTPVLTFEEALHHQHNRERASFITDGEQLPSPRPAPLLSRTPAVPSAK
FT                   RDPSVGEHTVEVLREYGFSQEEILQLHSDRIVESDKLKANL"
FT   polyA_signal    1500..1505
FT                   /note="putative"
FT   polyA_site      1523
FT                   /note="putative"
XX
SQ   Sequence 1523 BP; 365 A; 386 C; 414 G; 358 T; 0 other;
     ggctctcacc ctaaggctgg ccatggtgct gcgtggcgtc agggttgtgg agctggcagg        60
     cctggccccg gggccgttct gcggaatggt cctggcggac ttcggcgccg aggtggtgcg       120
     cgtgaaccgg ctgggctcca cgggcgagaa ttttctggcc cgaggcaagc gctcgctagc       180
     gctggacctg aagcgctctc agggagtcac ggtgttgcgg cgcatgtgcg cacgcgcgga       240
     cgtgttgctg gagcccttcc gctgcggtgt catggagaaa ctccagcttg ggccagagac       300
     tctactgcag gacaatccaa agctcatcta tgccaggctg agcggatttg gccaatcggg       360
     aattttctcc aaagtagctg gccatgacat caactatttg gctttatcag gcgttctgtc       420
     aaagattggc agaagcggtg agaaccccta cccaccgctg aatctcctgg ctgactttgg       480
     cggtggaggc ctcatgtgca cactgggcat tgtgctggct ctctttgaac gcacacgctc       540
     tggccgaggg caggtcatcg attcaagcat ggtggaaggg actgcatact taagttcttt       600
     cctgtggaaa acccagccca tgggtctgtg gaaacagcct cgaggacaaa acatcttaga       660
     tggcggtgca cctttctaca caacctacaa gacggcagac ggggagttca tggctgtagg       720
     tgccatagaa ccccagttct atgcactgct gcttaaagga cttggactcg agtctgagga       780
     actcccctcc cagatgagct cagcagattg gccagagatg aagaagaaat ttgcagatgt       840
     gtttgcaaag aagactaagg cagaatggtg ccagatcttt gacgggacag atgcgtgtgt       900
     gaccccagtg ctgacgtttg aggaggccct ccaccaccag cacaacagag aacgggcctc       960
     cttcatcact gatggggagc agctcccgag cccccgccct gcacctctgc tttccagaac      1020
     tcctgccgtc ccatctgcca aaagggaccc ttctgtaggg gagcacaccg tagaagtgct      1080
     tagagagtat ggattcagtc aggaagagat ccttcagctg cactcagata gaatcgttga      1140
     aagtgataag ctaaaagcca atctctgact caggcttata gctcaagaga atctgaaggc      1200
     tgcatctcca ctggggaggg atgcccacaa ttgtgtgtat ggaaatgtgg atgaacagca      1260
     atgaagtcat ccaaatatcc caatcacgat ccaacgaaag gctggttaca ggataacgat      1320
     tgcgccctta cgctgcttat cagagcctct gattgaggaa aatttgtgtg tgtgtactga      1380
     tagtaacttg tggcagcttt ctgcctttca gttcccttgg tgaagtgtat ccatttatta      1440
     aaaccctttt ataaatacaa ctctgatcat atattaaata aactattata actttaataa      1500
     ataaaactct tgttttcctc ccc                                              1523
//


spacer
spacer