spacer

EBI Dbfetch

ID   AK002392; SV 1; linear; mRNA; HTC; MUS; 896 BP.
XX
AC   AK002392;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 22)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610009G07 product:glutathione S-transferase, theta 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-896
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b9a6c1c1304eb909ad0e76082bc6e283.
DR   Ensembl-Gn; ENSMUSG00000033318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038257; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610009G07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..896
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610009G07"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             126..860
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glutathione S-transferase, theta 2 (MGD|MGI:106188)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61133"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:106188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61133"
FT                   /protein_id="BAB22065.1"
FT                   /translation="MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQF
FT                   SQVNCLNKVPVLKDGSFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHAD
FT                   NIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVT
FT                   LADLMSLEELMQPVALGYNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAK
FT                   KMLPVPPPEVHASMQLRIARIP"
FT   polyA_signal    875..880
FT                   /note="putative"
FT   polyA_site      896
FT                   /note="putative"
XX
SQ   Sequence 896 BP; 205 A; 238 C; 256 G; 197 T; 0 other;
     gaagatcagc aggtgtcagc tatccagagg aggaaatcgt ttggcttggc caactgaggc        60
     tgtgctggac cccagcttgc tgttatcgaa cgcagtcggc acaccatctt gtgtcgctac       120
     cggcaatggg cttggagctc tacctggacc tgctgtcaca acccagccgc gctgtctaca       180
     tcttcgccaa gaagaatggc atccccttcc agacgcgtac cgtggatata ctcaaagggc       240
     agcacatgag cgagcaattc tcccaggtga actgcttaaa caaagttcct gtactcaaag       300
     acggaagctt cgtgttgacc gaaagcacag ccatcttgat ttacctgagt tccaagtacc       360
     aggtggcaga ccactggtac ccggccgacc tacaggcccg tgcccaagtc cacgaatacc       420
     tgggctggca tgccgacaac atccgtggta ctttcggagt gctcctatgg accaaggtgt       480
     tggggccact cattggggtc caggttcccc aggagaaggt ggaacggaac agagatagaa       540
     tggtcctggt tctgcaacag ctggaggaca agttcctcag ggacagggcc ttccttgttg       600
     gccagcaggt gacgctagcg gatctcatgt ctctggagga gttgatgcag cccgtggctc       660
     ttggctataa cctgtttgag ggacggcctc agctgacagc atggcgagag agggtggagg       720
     cgttcttggg tgctgagctg tgtcaggagg ctcatagcac catcctgagc atcctgggac       780
     aggcagccaa gaaaatgtta ccagtacccc ctccggaggt ccatgccagc atgcagcttc       840
     gaattgctag gattccttga gtggtctgac cagcaataaa aactcatttt gtgttt           896
//


spacer
spacer