Dbfetch

ID   AK001614; SV 1; linear; mRNA; STD; HUM; 2697 BP.
XX
AC   AK001614;
XX
DT   22-FEB-2000 (Rel. 62, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens cDNA FLJ10752 fis, clone NT2RP3004480, weakly similar to
DE   VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN VPS35.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2697
RA   Isogai T., Otsuki T.;
RT   ;
RL   Submitted (16-FEB-2000) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Isogai T., Ota T., Hayashi K., Sugiyama T., Otsuki T., Suzuki Y.,
RA   Nishikawa T., Nagai K., Sugano S., Aotsuka S., Yoshikawa Y., Matsunawa H.,
RA   Ishii S., Kawai Y., Saito K., Yamamoto J., Wakamatsu A., Nakamura Y.,
RA   Nagahari K., Masuho Y., Sasaki N.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 136c6f40a4bb87e738596608836e0250.
DR   Ensembl-Gn; ENSG00000069329; homo_sapiens.
DR   Ensembl-Tr; ENST00000299138; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   International Trade and Industry of Japan; cDNA full insert
CC   sequencing: Research Association for Biotechnology; cDNA library
CC   construction, 5'- & 3'-end one pass sequencing and clone
CC   selection: Helix Research Institute (supported by Japan Key
CC   Technology Center etc.) and Department of Virology, Institute of
CC   Medical Science, University of Tokyo.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2697
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NT2RP3"
FT                   /clone="NT2RP3004480"
FT                   /cell_line="NT2"
FT                   /cell_type="teratocarcinoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="mRNA from NT2 neuronal precursor cells after 2-weeks
FT                   retinoic acid (RA) induction."
FT                   /db_xref="taxon:9606"
FT   CDS             48..2438
FT                   /codon_start=1
FT                   /db_xref="GOA:Q96QK1"
FT                   /db_xref="H-InvDB:HIT000004088.16"
FT                   /db_xref="HGNC:HGNC:13487"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:2R17"
FT                   /db_xref="PDB:5F0J"
FT                   /db_xref="PDB:5F0K"
FT                   /db_xref="PDB:5F0L"
FT                   /db_xref="PDB:5F0M"
FT                   /db_xref="PDB:5F0P"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96QK1"
FT                   /protein_id="BAA91790.1"
FT                   /translation="MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKH
FT                   ASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNI
FT                   IPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPD
FT                   EGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGT
FT                   NLVRLSQLEGVNVERYKQIVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNP
FT                   FLRACAELHQNVNVKNIIIALIDRLALFAHREDGPGIPADIKLFDIFSQQVATVIQSRQ
FT                   DMPSEDVVSLQVSLINLAMKCYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELT
FT                   RLLKIPVDTYNNILTVLKLKHFHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVD
FT                   SIMNLVSTLIQDQPDQPVEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHF
FT                   GAGGNQRIGFTLPPLVFAAYQLAFRYKENSKVDDKWEKKCQKIFSFAHQTISALIKAEL
FT                   AELPLRLFLQGALAAGEIGFENHETVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTF
FT                   ERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGE
FT                   RVMECLKKALKIANQCMDPSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIRED
FT                   LPNLESSEETEQINKHFHNTLEHLRLRRESPESEGPIYEGLIL"
XX
SQ   Sequence 2697 BP; 810 A; 539 C; 591 G; 757 T; 0 other;
     aaaaaaaaaa agcgggtgct gcttgctgca ggctctgggg agtcgccatg cctacaacac        60
     agcagtcccc tcaggatgag caggaaaagc tcttggatga agccatacag gctgtgaagg       120
     tccagtcatt ccaaatgaag agatgcctgg acaaaaacaa gcttatggat gctctaaaac       180
     atgcttctaa tatgcttggt gaactccgga cttctatgtt atcaccaaag agttactatg       240
     aactttatat ggccatttct gatgaactgc actacttgga ggtctacctg acagatgagt       300
     ttgctaaagg aaggaaagtg gcagatctct acgaacttgt acagtatgct ggaaacatta       360
     tcccaaggct ttaccttttg atcacagttg gagttgtata tgtcaagtca tttcctcagt       420
     ccaggaagga tattttgaaa gatttggtag aaatgtgccg tggtgtgcaa catcccttga       480
     ggggtctgtt tcttcgaaat taccttcttc agtgtaccag aaatatctta cctgatgaag       540
     gagagccaac agatgaagaa acaactggtg acatcagtga ttccatggat tttgtactgc       600
     tcaactttgc agaaatgaac aagctctggg tgcgaatgca gcatcaggga catagccgag       660
     atagagaaaa aagagaacga gaaagacaag aactgagaat tttagtggga acaaatttgg       720
     tgcgcctcag tcagttggaa ggtgtaaatg tggaacgtta caaacagatt gttttgactg       780
     gcatattgga gcaagttgta aactgtaggg atgctttggc tcaagaatat ctcatggagt       840
     gtattattca ggttttccct gatgaatttc acctccagac tttgaatcct tttcttcggg       900
     cctgtgctga gttacaccag aatgtaaatg tgaagaacat aatcattgct ttaattgata       960
     gattagcttt atttgctcac cgtgaagatg gacctggaat cccagcggat attaaacttt      1020
     ttgatatatt ttcacagcag gtggctacag tgatacagtc tagacaagac atgccttcag      1080
     aggatgttgt atctttacaa gtctctctga ttaatcttgc catgaaatgt taccctgatc      1140
     gtgtggacta tgttgataaa gttctagaaa caacagtgga gatattcaat aagctcaacc      1200
     ttgaacatat tgctaccagt agtgcagttt caaaggaact caccagactt ttgaaaatac      1260
     cagttgacac ttacaacaat attttaacag tcttgaaatt aaaacatttt cacccactct      1320
     ttgagtactt tgactacgag tccagaaaga gcatgagttg ttatgtgctt agtaatgttc      1380
     tggattataa cacagaaatt gtctctcaag accaggtgga ttccataatg aatttggtat      1440
     ccacgttgat tcaagatcag ccagatcaac ctgtagaaga ccctgatcca gaagattttg      1500
     ctgatgagca gagccttgtg ggccgcttca ttcatctgct gcgctctgag gaccctgacc      1560
     agcagtactt gattttgaac acagcacgaa aacattttgg agctggtgga aatcagcgga      1620
     ttggcttcac actgccacct ttggtatttg cagcttacca gctggctttt cgatataaag      1680
     agaattctaa agtggatgac aaatgggaaa agaaatgcca gaagattttt tcatttgccc      1740
     accagactat cagtgctttg atcaaagcag agctggcaga attgccctta agactttttc      1800
     ttcaaggagc actagctgct ggggaaattg gttttgaaaa tcatgagaca gtcgcatatg      1860
     aattcatgtc ccaggcattt tctctgtatg aagatgaaat cagcgattcc aaagcacagc      1920
     tagctgccat caccttgatc attggcactt ttgaaaggat gaagtgcttc agtgaagaga      1980
     atcatgaacc tctgaggact cagtgtgccc ttgctgcatc caaacttcta aagaaacctg      2040
     atcagggccg agctgtgagc acctgtgcac atctcttctg gtctggcaga aacacggaca      2100
     aaaatgggga ggagcttcac ggaggcgaga gggtaatgga gtgcctaaaa aaagctctaa      2160
     aaatagcaaa tcagtgcatg gacccctctc tacaagtgca gctttttata gaaattctga      2220
     acagatatat ctatttttat gaaaaggaaa atgatgcggt aacaattcag gttttaaacc      2280
     agcttatcca aaagattcga gaagacctcc cgaatcttga atccagtgaa gaaacagagc      2340
     agattaacaa acattttcat aacacactgg agcatttgcg cttgcggcgg gaatcaccag      2400
     aatccgaggg gccaatttat gaaggtctca tcctttaaaa aggaaatagc tcaccatact      2460
     cctttccatg tacatccagt gagggtttta ttacgctagg tttcccttcc atagattgtg      2520
     cctttcagaa atgctgaggt aggtttccca tttcttacct gtgatgtgtt ttacccagca      2580
     cctccggaca ctcaccttca ggaccttaat aaaattattc acttggtaag tgttcaagtc      2640
     tttctgatca ccccaagtag catgactgat ctgcaattta aaattcctgt gatctgt         2697
//