spacer

EBI Dbfetch

ID   AK000395; SV 1; linear; mRNA; STD; HUM; 1133 BP.
XX
AC   AK000395;
XX
DT   22-FEB-2000 (Rel. 62, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens cDNA FLJ20388 fis, clone KAIA4517.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1133
RA   Sugano S., Suzuki Y., Ota T., Obayashi M., Nishi T., Isogai T.,
RA   Shibahara T., Tanaka T., Nakamura Y.;
RT   ;
RL   Submitted (15-FEB-2000) to the INSDC.
RL   Sumio Sugano, Institute of Medical Science, University of Tokyo, Deptment
RL   of Virology; Shirokane-dai, 4-6-1, Minato-ku, Tokyo 108-8639, Japan
RL   (E-mail:flcdna@ims.u-tokyo.ac.jp, Tel:81-3-5449-5286, Fax:81-3-5449-5416)
XX
RN   [2]
RA   Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M.,
RA   Ohmori Y., Ota T., Suzuki Y., Obayashi M., Nishi T., Shibahara T.,
RA   Tanaka T., Nakamura Y., Isogai T., Sugano S.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 70c46f794837ce0b514db83acff5940c.
DR   Ensembl-Gn; ENSG00000069329; homo_sapiens.
DR   Ensembl-Tr; ENST00000299138; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   International Trade and Industry of Japan; cDNA full insert
CC   sequencing: Research Association for Biotechnology; cDNA library
CC   construction, 5'- & 3'-end one pass sequencing: Departent of
CC   Virology and Human Genome Center, Institute of Medical Science,
CC   University of Tokyo (partly supported by Science and Technology
CC   Agency).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1133
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="kaia"
FT                   /clone="KAIA4517"
FT                   /tissue_type="ileal mucosa"
FT                   /note="cloning vector pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             279..851
FT                   /codon_start=1
FT                   /db_xref="GOA:Q96QK1"
FT                   /db_xref="H-InvDB:HIT000002870.17"
FT                   /db_xref="HGNC:HGNC:13487"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:2R17"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96QK1"
FT                   /protein_id="BAA91137.1"
FT                   /translation="MSQAFSLYEDEISDSKAQLAAITLIIGTFERMKCFSEENHEPLRT
FT                   QCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQC
FT                   MDPSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKH
FT                   FHNTLEHLRLRRESPESEGPIYEGLIH"
XX
SQ   Sequence 1133 BP; 357 A; 237 C; 236 G; 303 T; 0 other;
     gaaaacactt tggagctggt ggaaatcagc ggattcgctt cacactgcca cctttggtat        60
     ttgcagctta ccagctggct tttcgatata aagagaattc taaagtggat gacaaatggg       120
     aaaagaaatg ccagaagatt ttttcatttg cccaccagac tatcagtgct ttgatcaaag       180
     cagagctggc agaattgccc ttaagacttt ttcttcaagg agcactagct gctggggaaa       240
     ttggttttga aaatcatgag acagtcgcat atgaattcat gtcccaggca ttttctctgt       300
     atgaagatga aatcagcgat tccaaagcac agctagctgc catcaccttg atcattggca       360
     cttttgaaag gatgaagtgc ttcagtgaag agaatcatga acctctgagg actcagtgtg       420
     cccttgctgc atccaaactt ctaaagaaac ctgatcaggg ccgagctgtg agcacctgtg       480
     cacatctctt ctggtctggc agaaacacgg acaaaaatgg ggaggagctt cacggaggca       540
     agagggtaat ggagtgccta aaaaaagctc taaaaatagc aaatcagtgc atggacccct       600
     ctctacaagt gcagcttttt atagaaattc tgaacagata tatctatttt tatgaaaagg       660
     aaaatgatgc ggtaacaatt caggttttaa accagcttat ccaaaagatt cgagaagacc       720
     tcccgaatct tgaatccagt gaagaaacag agcagattaa caaacatttt cataacacac       780
     tggagcattt gcgcttgcgg cgggaatcac cagaatccga ggggccaatt tatgaaggtc       840
     tcatccatta aaaaggaaat agctcaccat actcctttcc atgtacatcc agtgagggtt       900
     ttattacgct aggtttccct tccatagatt gtgcctttca gaaatgctga ggtaggtttc       960
     ccatttctta cctgtgatgt gttttaccca gcacctccgg acactcacct tcaggacctt      1020
     aataaaatta ttcacttggt aagtgttcaa gtctttctga tcaccccaag tagcatgact      1080
     gatctgcaat ttaaaattcc tgtgatctgt aaaaaaaaaa aaaaaaaaaa aaa             1133
//


spacer
spacer