spacer

EBI Dbfetch

ID   AJ853708; SV 1; linear; genomic DNA; STD; HUM; 306 BP.
XX
AC   AJ853708;
XX
DT   29-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*13
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*13 allele; human leucocyte antigen DRB1;
KW   major histocompatability complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-306
RA   Binder T.M.C.;
RT   ;
RL   Submitted (29-OCT-2004) to the INSDC.
RL   Binder T.M.C., University Hospital Hamburg-Eppendorf, HLA Laboratory,
RL   Transfusion Medicine, Martinistrasse 52, D-20246 Hamburg, GERMANY.
XX
RN   [2]
RA   Binder T.M.C., Mosebach M., Kuehnl P., Heim M.U., Blasczyk R.,
RA   Eiermann T.H.;
RT   "A new HLA-DRB1*13 variant similar to DRB1*130201 and DRB3*020101.";
RL   Unpublished.
XX
DR   MD5; f9a4f440faabe9fd9d8f04e80965b8c0.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..306
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <19..>288
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*13"
FT                   /product="HLA-DRB1*13 variant"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:67"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="CAH68606.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 306 BP; 61 A; 76 C; 113 G; 56 T; 0 other;
     tcgttcgtgt ccccacagca cgtttcttgg agctgcttaa gtctgagtgt catttcttca        60
     atgggacgga gcgggtgcgg ttcctggaca gatacttcca taaccaggag gagaacgtgc       120
     gcttcgacag cgacgtgggg gagttccggg cggtgacgga gctggggcgg cctgatgccg       180
     agtactggaa cagccagaag gacatcctgg aagacgagcg ggccgcggtg gacacctact       240
     gcagacacaa ctacggggtt ggtgagagct tcacagtgca gcggcgaggt gagcgcggcg       300
     cggggc                                                                  306
//


spacer
spacer