Dbfetch

ID   AJ812566; SV 1; linear; genomic DNA; STD; HUM; 283 BP.
XX
AC   AJ812566;
XX
DT   02-SEP-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, exon 2,
DE   HLA-DRB1*11 allele
XX
KW   HLA-DRB1 gene; HLA-DRB1*11 allele; human leukocyte antigen B;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-283
RA   Velickovic Z.;
RT   ;
RL   Submitted (01-SEP-2004) to the INSDC.
RL   Velickovic Z., Tissue Typing, Molecular Genetics, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, AUSTRALIA.
XX
RN   [2]
RA   Velickovic Z.M.;
RT   "Novel HLA-DRB1*11 allele";
RL   Unpublished.
XX
DR   MD5; edfe3ff2c8ffd66c0f008ba03b4211a9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..283
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>283
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT   intron          <1..13
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /number=1
FT   CDS             <14..>283
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:23:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="CAH23708.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            14..283
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /number=2
XX
SQ   Sequence 283 BP; 57 A; 69 C; 103 G; 54 T; 0 other;
     cgtgtcccca cagcacgttt cttggagtac tctacgtctg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggacagatac ttccataacc aggaggagtt cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctga tgcggagtac       180
     tggaacagcc agaaggacct cctggagcgg aggcgggccg aggtggacac ctattgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc gag                         283
//