spacer

EBI Dbfetch

ID   AJ810517; SV 1; linear; mRNA; STD; MUS; 662 BP.
XX
AC   AJ810517;
XX
DT   18-AUG-2004 (Rel. 80, Created)
DT   18-AUG-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Mus musculus partial mRNA for voltage-gated sodium channel alpha subunit
DE   Nav1.3 (Scn3a gene)
XX
KW   Scn3a gene; sodium channel, voltage-gated, type III, alpha polypeptide;
KW   voltage-gated sodium channel alpha subunit  Nav1.3.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-662
RA   Zimmer T.;
RT   ;
RL   Submitted (13-AUG-2004) to the INSDC.
RL   Zimmer T., Institute of Physiology II, Friedrich Schiller University Jena,
RL   Teichgraben 8, 07740 Jena, GERMANY.
XX
RN   [2]
RA   Haufe V., Camacho J.A., Guenther B., Dumaine R., Bollensdorff C.,
RA   Segond von Banchet G., Benndorf K., Zimmer T.;
RT   "Expression pattern of neuronal and skeletal muscle voltage-gated sodium
RT   channels in the developing mouse heart";
RL   Unpublished.
XX
DR   MD5; b094c404bec1621f4b1c7d87c4f1a5cc.
DR   Ensembl-Gn; ENSMUSG00000057182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066432; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100069; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..662
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>660
FT                   /codon_start=1
FT                   /gene="Scn3a"
FT                   /product="voltage-gated sodium channel alpha subunit
FT                   Nav1.3"
FT                   /note="sodium channel, voltage-gated, type III, alpha
FT                   polypeptide"
FT                   /db_xref="GOA:Q68V26"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028808"
FT                   /db_xref="MGI:MGI:98249"
FT                   /db_xref="UniProtKB/TrEMBL:Q68V26"
FT                   /protein_id="CAH17961.1"
FT                   /translation="QKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGM
FT                   VFDFVTRQVFDISIMILICLNMVTMMVETDDQSKYMTLVLSRINLVFIVLFTGEFLLKL
FT                   ISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIK
FT                   GAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEAGIDDMFNFE"
XX
SQ   Sequence 662 BP; 170 A; 162 C; 144 G; 186 T; 0 other;
     cagaagaaga agtttggagg tcaagacatc tttatgacag aagagcagaa aaagtactac        60
     aatgcaatga agaaacttgg ctccaaaaaa cctcagaagc ccatccctcg acctgcaaac       120
     aaatttcaag gaatggtctt tgactttgta accagacaag tgtttgacat cagcatcatg       180
     atcctcatct gcctcaacat ggtgaccatg atggtggaaa cggacgacca gagcaaatac       240
     atgaccctgg ttttgtcccg aatcaacctg gtattcatcg tcctcttcac tggggagttt       300
     ctgctgaagc tcatctctct cagatactac tacttcacga ttggctggaa catctttgac       360
     tttgtggtgg tgattctctc aattgtagga atgttccttg ctgagctgat agagaagtat       420
     tttgtgtctc ctaccctgtt ccgagtcatc cgcctggcca ggattggacg aatcctacgc       480
     ctgatcaaag gcgccaaggg gatccgcacg ctgctctttg ctctgatgat gtcccttcct       540
     gcgctgttca acatcggcct cctgcttttc ctcgtcatgt tcatctacgc catctttggg       600
     atgtccaact ttgcctatgt taaaaaagag gctggaattg atgacatgtt caactttgag       660
     ac                                                                      662
//


spacer
spacer