spacer

EBI Dbfetch

ID   AJ581744; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ581744;
XX
DT   01-MAR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, DR0809var
DE   allele, exon 2
XX
KW   DR0809var allele major histocompatibility complex; HLA-DRB1 gene;
KW   MHC class I antigen; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Tiercy J.M.;
RT   ;
RL   Submitted (01-SEP-2003) to the INSDC.
RL   Tiercy J.M., Transplantation Immunology Unit/LNRH, University Hospital of
RL   Geneva, 24 rue Micheli-du Crest, 1211 Geneva 14, SWITZERLAND.
XX
RN   [2]
RA   Kervaire B., Villard J., Tiercy J.M.;
RT   "An unusual HLA-DR/DQ haplotype carrying a new DR8 variant and the
RT   DRB3*0202 allele";
RL   Unpublished.
XX
DR   MD5; 25b62d59ed9ebe0eb5613e7908e95728.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /serotype="HLA-DR8"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DR0809var"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="CAE46451.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRALVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DR0809var"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 63 C; 98 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer