Dbfetch

ID   AJ579852; SV 2; linear; mRNA; STD; MUS; 5955 BP.
XX
AC   AJ579852;
XX
DT   06-AUG-2003 (Rel. 76, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus mRNA for L-type dihydropyridine-sensitive calcium channel
DE   alpha-1f subunit (Cav1.4 gene), strain C57Bl6
XX
KW   Cav1.4 gene;
KW   L-type dihydropyridine-sensitive calcium channel alpha-1f subunit.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RC   revised by [3]
RA   Gerstner A.;
RT   ;
RL   Submitted (04-AUG-2003) to the INSDC.
RL   Gerstner A., Pharmacy, Pharmacology, LMU Munich, Butenandtstr. 7, 81377,
RL   GERMANY.
XX
RN   [2]
RX   DOI; 10.1167/iovs.03-0937.
RX   PUBMED; 14744918.
RA   Baumann L., Gerstner A., Zong X., Biel M., Wahl-Scott C.;
RT   "Functional characterization of the L-type Ca2+ channel Cav1.4alpha1 from
RT   mouse retina";
RL   Invest Ophthalmol Vis Sci 45(2):708-713(2004).
XX
RN   [3]
RP   1-5955
RA   Gerstner A.;
RT   ;
RL   Submitted (16-NOV-2004) to the INSDC.
RL   Gerstner A., Pharmacy, Pharmacology, LMU Munich, Butenandtstr. 7, 81377,
RL   GERMANY.
XX
DR   MD5; c67ebe1a068e86bf30e3abcc7714a599.
DR   Ensembl-Gn; ENSMUSG00000031142; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035514; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035492; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035425; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035488; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035196; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036012; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034496; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035166; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035323; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035270; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035400; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035309; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036030; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034198; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034619; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000115726; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0095452; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0095538; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0095489; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0095460; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095018; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095975; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0095627; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0094940; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0095148; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095005; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0095166; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094973; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0096310; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095046; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094003; mus_musculus_wsbeij.
DR   EuropePMC; PMC1622877; 17028172.
DR   EuropePMC; PMC2785611; 19717559.
DR   EuropePMC; PMC3476298; 22936811.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5955
FT                   /organism="Mus musculus"
FT                   /strain="C57Bl6"
FT                   /mol_type="mRNA"
FT                   /country="Germany"
FT                   /tissue_type="eye"
FT                   /db_xref="taxon:10090"
FT   CDS             1..5955
FT                   /gene="Cav1.4"
FT                   /product="L-type dihydropyridine-sensitive calcium channel
FT                   alpha-1f subunit"
FT                   /function="involved in voltage dependent calcium influx
FT                   transmitted to neurons of the retina"
FT                   /db_xref="GOA:Q7TNI3"
FT                   /db_xref="InterPro:IPR002077"
FT                   /db_xref="InterPro:IPR005446"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014873"
FT                   /db_xref="InterPro:IPR030157"
FT                   /db_xref="InterPro:IPR031649"
FT                   /db_xref="InterPro:IPR031688"
FT                   /db_xref="MGI:MGI:1859639"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TNI3"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAE30292.1"
FT                   /translation="MSESEVGKDTTPEPSPANGTGPGPEWGLCPGPPTVGTDTSGASGL
FT                   GTPRRRTQHNKHKTVAVASAQRSPRALFCLTLTNPIRRSCISIVEWKPFDILILLTIFA
FT                   NCVALGVYIPFPEDDSNTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGW
FT                   NLLDFIIVVVGLFSVLLEQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPS
FT                   LHIVLNSIMKALVPLLHIALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPS
FT                   PCASSGSGRSCTLNHTECRGRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQ
FT                   DAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQMEE
FT                   DLRGYLDWITQAEELDLHDPSVDGNLASLAEEGRAGHRPQLSELTNRRRGRLRWFSHST
FT                   RSTHSTSSHASLPASDTGSMTDTPGDEDEEEGTMASCTRCLNKIMKTRICRHFRRANRG
FT                   LRARCRRAVKSNACYWAVLLLVFLNTLTIASEHHGQPLWLTQTQEYANKVLLCLFTVEM
FT                   LLKLYGLGPSVYVASFFNRFDCFVVCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKV
FT                   TRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTF
FT                   DTFPQALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCVYFIILFICGNYILLNVF
FT                   LAIAVDNLASGDAGTAKDKGREKSSEGNPPKENKVLVPGGENEDAKGARSEGAAPGMEE
FT                   EEEEEEEEEEEEEEENGAGHVELLQEVVPKEKVVPIPEGSAFFCLSQTNPLRKACHTLI
FT                   HHHIFTSLILVFIILSSVSLAAEDPIRAHSFRNHILGYFDYAFTSIFTVEILLKMTVFG
FT                   AFLHRGSFCRSWFNLLDLLVVSVSLISFGIHSSAISVVKILRVLRVLRPLRAINRAKGL
FT                   KHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYSCTDEAKHTLKECKGSFL
FT                   IYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDANAEDEG
FT                   PIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFRAQGEQEYQNCELDKNQRQCVEY
FT                   ALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMFLLILLNTVALAMQHYEQTAPFNYAM
FT                   DILNMVFTGLFTIEMVLKIIAFKPKHYFADAWNTFDALIVVGSVVDIAVTEVNNGGHLG
FT                   ESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIAMIFFI
FT                   YAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLASLPGNRCD
FT                   PESDFGPGEEFTCGSSFAIVYFISFFMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHH
FT                   LDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLVAMNVPLNS
FT                   DGTVTFNATLFALVRTSLKIKTEGNLDQANQELRMVIKKIWKRIKQKLLDEVIPPPDEE
FT                   EVTVGKFYATFLIQDYFRKFRRRKEKGLLGREAPTSTSSALQAGLRSLQDLGPEIRQAL
FT                   TYDTEEEEEEEEAVGQEAEEEEAENNPEPYKDSIDSQPQSRWNSRISVSLPVKEKLPDS
FT                   LSTGPSDDDGLAPNSRQPSVIQAGSQPHRRSSGVFMFTIPEEGSIQLKGTQGQDNQNEE
FT                   QEVPDWTPDLDEQAGTPSNPVLLPPHWSQQHVNGHHVPRRRLLPPTPAGRKPSFTIQCL
FT                   QRQGSCEDLPIPGTYHRGRTSGPSRAQGSWAAPPQKGRLLYAPLLLVEESTVGEGYLGK
FT                   LGGPLRTFTCLQVPGAHPNPSHRKRGSADSLVEAVLISEGLGLFAQDPRFVALAKQEIA
FT                   DACHLTLDEMDSAASDLLAQRTTSLYSDEESILSRFDEEDLGDEMACVHAL"
XX
SQ   Sequence 5955 BP; 1377 A; 1632 C; 1542 G; 1404 T; 0 other;
     atgtcggaat ctgaagtcgg gaaagataca accccagagc ccagtccagc caatgggact        60
     ggccctggcc ctgaatgggg gctctgtcct gggcctccaa ctgtggggac tgataccagc       120
     ggggcgtcag gcctggggac cccaagaaga aggacccagc acaacaaaca caagactgtg       180
     gcggtggcca gtgctcagag atcacctcga gcgctcttct gcctcaccct tactaatccc       240
     attcgtcggt cctgcatcag cattgtagag tggaagcctt ttgatattct catcctcctg       300
     acaatctttg ccaactgcgt ggcattgggg gtatatatcc ccttccctga ggacgactcc       360
     aacactgcta accacaactt ggaacaggta gaatacgtgt tcctggtgat tttcaccgtg       420
     gagacagtgc tcaagatcgt agcctatggg ctggtgctcc atcccagcgc ctatattcgc       480
     aatggctgga acctgctcga cttcatcatc gtcgtggtcg ggctgttcag cgtgctgctg       540
     gaacaaggac ctgggcggcc aggagatgcc ccgcatactg gaggaaagcc aggaggcttc       600
     gatgtaaagg cactgcgggc atttagggtg ctacgacctc taaggctagt gtctggggtc       660
     ccgagtctgc acatagtgct caattccatc atgaaggcgc ttgtgccgct gctgcacatt       720
     gccctgttgg tgctcttcgt cattatcatt tacgccatca tcggactcga gctattcctc       780
     ggacgaatgc acaagacatg ctacttcctg ggatctgata tggaagcaga ggaggaccca       840
     tcaccttgtg catcttctgg ctctgggcgt tcatgcacac tgaaccatac cgagtgccgc       900
     gggcgctggc caggacccaa cggtggcatc acgaacttcg acaatttttt ctttgccatg       960
     ctaactgtgt tccagtgtat taccatggaa ggctggacag acgtcctcta ctggatgcag      1020
     gatgccatgg ggtatgagct gccttgggtg tactttgtga gccttgtcat ctttgggtcc      1080
     ttctttgtcc tcaaccttgt gcttggagtc ctaagcgggg agttctccaa ggaaagagaa      1140
     aaggcaaaag cacgaggtga ctttcagaag cttcgggaga agcagcagat ggaagaagac      1200
     cttcggggct acctggactg gatcacacag gctgaggagt tagaccttca tgacccctca      1260
     gtagacggca acttggcttc tcttgctgaa gagggacggg cgggccatcg gccacaactg      1320
     tcagagctga ccaataggag gcgcggacgg ctgcgatggt tcagccactc tactcgctcc      1380
     acacactcca ccagcagcca cgccagcctc ccagccagtg acactggctc catgacagac      1440
     acccctggag atgaggatga agaagagggg accatggcta gctgtacacg ctgcctaaac      1500
     aagattatga aaacaaggat ctgccgccac ttccgccgag ccaaccgggg tctccgtgca      1560
     cgctgccgcc gggccgtcaa gtccaacgcc tgctactggg ctgtactgtt gctcgtcttc      1620
     ctcaacacgt tgaccatagc ttcagagcac catgggcagc ctttgtggct cacccagacc      1680
     caagagtatg ccaacaaagt tctgctctgc ctcttcactg tggagatgct cctcaaactg      1740
     tacggcctgg gcccctctgt ctacgttgcc tcctttttca accgctttga ctgcttcgtg      1800
     gtctgtgggg gcatcctaga aaccactttg gtggaggtgg gggccatgca gcctcttggc      1860
     atctcagtgc tccgatgtgt acgtctcctc aggatcttca aggtcaccag gcactgggca      1920
     tccctgagca atctggtggc atctttgctc aattccatga agtccatcgc ctccttgctg      1980
     cttctcctct ttctcttcat catcatcttc tccctgcttg gcatgcagct gtttgggggc      2040
     aagttcaact ttgaccagac ccacaccaag aggagcacct ttgatacctt cccccaagcc      2100
     ctcctcactg tctttcagat cctgactggt gaggattgga acgttgtcat gtatgatggt      2160
     atcatggcct acggtgggcc cttcttccca gggatgctgg tgtgtgttta tttcatcatc      2220
     ctcttcatct gtggcaacta catcctgctg aacgtgtttc ttgccattgc cgtggataac      2280
     ctagccagcg gggatgcagg cactgccaaa gacaagggca gagagaagag cagtgaagga      2340
     aaccctccaa aggagaacaa agtattggtg cctggtggag agaatgagga cgcaaagggt      2400
     gcaagaagtg aaggagcagc accaggcatg gaggaggagg aggaggagga agaagaagaa      2460
     gaggaggagg aggaagagga aaatggtgca ggacatgtgg aactcttgca ggaagtagta      2520
     cccaaggaga aggtggtacc catccctgaa ggcagtgcct tcttctgcct tagccaaacc      2580
     aacccgcttc ggaaggcctg ccacacactc atacatcacc atatcttcac cagtctcatc      2640
     ctagtgttca tcatcctcag tagtgtgtcc ctggctgctg aggaccccat ccgagctcac      2700
     tccttccgaa accatattct gggatatttt gattatgcct tcacctccat attcactgtg      2760
     gagattctac tcaagatgac agtgtttggg gccttcctgc accgaggctc tttctgccgt      2820
     agctggttca atctgttgga tctccttgtg gtcagtgtgt ccctcatctc cttcggcatc      2880
     cactccagtg ccatctcagt tgtgaagatt ctccgagtcc tccgagtcct gcggcctctc      2940
     cgagccatca acagagccaa gggactcaag catgtggtgc agtgtgtgtt cgtggccatc      3000
     cggaccatcg gaaacatcat gattgtcacc accctcttgc agttcatgtt cgcctgcatt      3060
     ggtgttcagc tgttcaaggg aaaattctac agttgcactg atgaggccaa acacaccctg      3120
     aaagaatgca agggctcctt cctcatctac cctgatggag atgtgtcacg acctttggtc      3180
     cgggagcggc tctgggtcaa cagtgatttt aactttgaca acgtcctttc agccatgatg      3240
     gccctgttca ctgtctctac ctttgaaggc tggcctgcgc tactatacaa ggccatagat      3300
     gcaaacgcag aagatgaggg ccctatctac aattaccatg tggagatatc agtattcttc      3360
     attgtctaca tcatcatcat cgccttcttc atgatgaaca tctttgtggg ctttgttatc      3420
     atcacattcc gtgcccaggg agagcaggag taccaaaact gtgaactgga caagaaccag      3480
     cgccagtgtg tggaatatgc cctcaaagct cagccactcc gccgatacat ccctaagaat      3540
     cctcatcagt accgcgtgtg ggccactgtg aactctgctg cctttgagta cctcatgttt      3600
     ctgctcatcc tgctcaacac ggtggcccta gccatgcagc actatgaaca gactgctccc      3660
     tttaactatg ccatggacat cctcaacatg gtcttcactg gcctcttcac cattgagatg      3720
     gtgctcaaaa tcatcgcctt taaacccaag cattactttg cagatgcctg gaatacgttt      3780
     gatgctctca ttgtagtggg cagtgtagtc gacatcgccg tcacagaagt caataacgga      3840
     ggccatcttg gcgagagttc agaggacagc tcccgcatat ctatcacgtt ctttcgcctc      3900
     ttccgagtca tgaggctggt caagcttctg agtaagggtg aggggatccg cacactgctc      3960
     tggacattca tcaagtcttt ccaggccttg ccctatgtgg cacttctcat agcaatgata      4020
     ttcttcatct atgcagtcat tggcatgcag atgtttggca aggtggctct tcaggacggc      4080
     acgcagataa atcgaaacaa caatttccag acctttccgc aggctgtgct gcttctgttc      4140
     aggtgtgcca ctggtgaggc ctggcaagag ataatgctag ccagccttcc aggaaatcga      4200
     tgtgaccctg agtctgactt tggcccaggc gaggaattta cctgtggtag cagttttgcc      4260
     atcgtctact tcatcagctt ctttatgctc tgtgccttcc tgattataaa tctctttgtg      4320
     gctgtaatca tggataactt tgattaccta accagagatt ggtctatcct gggaccccac      4380
     caccttgatg aattcaagag gatctggtct gaatatgacc ccggagccaa gggccgcatc      4440
     aagcacttgg atgtggttgc cctgctgaga cgcatccagc ccccattggg atttggaaag      4500
     ctatgcccac accgagtggc ctgcaagaga ctcgtggcaa tgaatgtgcc cctcaactca      4560
     gatggaacag tgacattcaa cgctacactc tttgccctgg tgcggacatc cctgaagatc      4620
     aagacagaag ggaacctgga tcaagccaac caggagcttc ggatggtcat caaaaagatc      4680
     tggaagcgga taaagcagaa attgttggat gaggtcatcc ctcctcccga tgaggaggag      4740
     gtcactgtgg gaaaattcta tgccacattc ctgatccaag attatttccg aaaattccgg      4800
     agaaggaaag aaaaggggct actaggaaga gaggccccaa caagcacatc ctctgccctc      4860
     caggctggtc taaggagcct gcaggacttg ggtcctgaga tccgtcaagc cctcacctat      4920
     gacactgagg aagaagagga agaggaagag gcagtgggtc aggaggctga ggaagaggaa      4980
     gctgagaaca acccagaacc atacaaagac tccatagact cccagcccca atctcgatgg      5040
     aactctagga tttcggtgtc tctacctgtt aaggagaaac ttccagattc tctctcaact      5100
     gggccgagtg atgatgatgg gctggctccc aactccaggc agcccagtgt gatacaggct      5160
     ggctcccaac cacacaggag aagctctggg gttttcatgt tcactatccc ggaagaagga      5220
     agtattcagc tcaagggaac tcaagggcag gacaatcaga atgaggaaca ggaagtccct      5280
     gactggactc ctgacctgga tgagcaggcc gggactcctt cgaacccagt ccttttacca      5340
     cctcactggt cccagcaaca cgtaaacggg caccatgtgc cacgccgacg tttgctgccc      5400
     cccacgcctg caggtcggaa gccctccttc accatccagt gtctgcaacg ccagggcagt      5460
     tgtgaagatt tacctatccc aggcacctac catcgtggac ggacctcagg accaagcagg      5520
     gctcagggtt cctgggcagc ccctcctcag aagggtcgac tgctatatgc ccccctgttg      5580
     ttggtggagg aatctacagt gggtgaagga taccttggca aacttggcgg cccactgcgt      5640
     accttcacct gtctgcaagt gcctggagct catccgaatc ccagccaccg caagaggggc      5700
     agtgctgaca gtttggtgga ggctgtgctc atctccgaag gcctaggtct ctttgcccaa      5760
     gacccacgat ttgtggccct ggccaagcag gagattgcag atgcatgtca cctgaccctg      5820
     gatgagatgg acagtgctgc cagtgacctg ctggcacaga gaaccacctc cctttacagt      5880
     gatgaggagt ctattctttc ccgctttgat gaagaggacc tgggagatga gatggcctgt      5940
     gtccatgccc tctaa                                                       5955
//