Dbfetch

ID   AJ543321; SV 1; linear; mRNA; STD; MUS; 4486 BP.
XX
AC   AJ543321;
XX
DT   01-APR-2003 (Rel. 75, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for NrCAM protein, splice variant 1
XX
KW   Alternative splicing; NrCAM gene; NrCAM protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4486
RA   Dirks P.;
RT   ;
RL   Submitted (06-FEB-2003) to the INSDC.
RL   Dirks P., Neurogenetik, Leibniz-Institut, Brenneckestr. 6, 39118 Magdeburg,
RL   GERMANY.
XX
RN   [2]
RA   Dirks P., Montag-Sallaz M., Montag D.;
RT   "Expression patterns of L1-family cell recognition molecules L1, CHL1,
RT   NrCAM,and neurofascin in the mouse brain";
RL   Unpublished.
XX
DR   MD5; 8497651f423d88539b5a5c14285eb877.
DR   Ensembl-Gn; ENSMUSG00000020598; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110748; mus_musculus.
DR   EuropePMC; PMC4138338; 25143608.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4486
FT                   /organism="Mus musculus"
FT                   /strain="swiss webster"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="OriGene MAB-1001"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             460..4215
FT                   /gene="NrCAM"
FT                   /product="NrCAM protein"
FT                   /db_xref="GOA:Q810U4"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026966"
FT                   /db_xref="MGI:MGI:104750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810U4"
FT                   /protein_id="CAD65848.1"
FT                   /translation="MPKKKHLSAGGVPLILFLCQMISALDVPLDLVQPPTITQQSPKDY
FT                   IIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGSGTLVINIMSEGKAE
FT                   TYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKERLEPIVLQNGQSLVLPCRPPIGLP
FT                   PAIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQP
FT                   ISLKVISVDELNDTIAANLSDTEFYGAKSSKERPPTFLTPEGNESHKEELRGNVLSLEC
FT                   IAEGLPTPIIYWIKEDGMLPANRTFYRNFKKTLQITHVSEADSGNYQCIAKNALGAVHH
FT                   TISVTVKAAPYWIVAPQNLVLSPGENGTLICRANGNPKPRISWLTNGVPIEIALDDPSR
FT                   KIDGDTIIFSNVQESSSAVYQCNASNKYGYLLANAFVNVLAEPPRILTSANTLYQVIAN
FT                   RPALLDCAFFGSPMPTIEWFKGTKGSALHEDIYVLHDNGTLEIPVAQKDSTGTYTCVAR
FT                   NKLGMAKNEVHLEIKDPTRIIKQPEYAVVQRGSKVSFECRVKHDHTLIPTIMWLKDNGE
FT                   LPNDERFSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASASAVLRVVAPTPTPAPIYDV
FT                   PNPPFDLELTNQLDKSVQLTWTPGDDNNSPITKFIIEYEDAMHDAGLWRHQAEVSGTQT
FT                   TAQLKLSPYVNYSFRVMAENSIGRSMPSEASEQYLTKAAEPDQNPMAVEGLGTEPDNLV
FT                   ITWKPLNGFQSNGPGLQYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQA
FT                   LNDVGFAPEPAAVMGHSGEDLPMVAPGNVRVSVVNSTLAEVHWDPVPPKSVRGHLQGYR
FT                   IYYWKTQSSSKRNRRHIEKKILTFQGTKTHGMLPGLQPYSHYALNVRVVNGKGEGPAST
FT                   DRGFHTPEGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNGILTEYILQYQPINSTHELGP
FT                   LVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSVGPGSQITEEAITTVDEAGIPPPDVG
FT                   AGKGKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGPAMASR
FT                   QVDIATQGWFIGLMCAVALLILILLIVCFIRRNKGGKYPVKEKEDAHADPEIQPMKEDD
FT                   GTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGEGVNGQFNEDGSFIGQYSG
FT                   KKEKEPAEGNESSEAPSPVNAMNSFV"
XX
SQ   Sequence 4486 BP; 1316 A; 1049 C; 1082 G; 1039 T; 0 other;
     gcacgagggc agctggaggc gacagcttcg gaagcttcgg aaacacgcac gacagctggg        60
     ctccggggtc ttaggcagta gcgccccggc agggaggtgg gcgcggcacg aaaacgaatt       120
     tttgtgctgc tctccagtga aagccagtac ccctatttgc tgaaggcttt ttaaccaagg       180
     ctgctttcag ctcttgacat tacccagaaa aaggtggact cagaaatcag ggaagcattg       240
     gaggtttctg accctgagga tcttctgaag agcaatgcta agaaaacctt tggcttaagg       300
     aattaaaacg aaataccact tcttcaagta agaagaccta cttcaaagtc ccctgcatga       360
     aaaattattt aaacgccgca caccaatctt ccgtgagaga agaaaaggaa attccgtgcg       420
     tgggtctcag caggagtgca gctgatgcag cttaaaataa tgccgaagaa gaagcactta       480
     tctgcaggcg gagtgcccct gattctcttc ctgtgccaga tgatcagcgc gctggatgtt       540
     cctctcgatc tggtacaacc tccaaccatc actcaacagt caccaaaaga ctacatcatt       600
     gaccctcggg agaatattgt aatccagtgt gaggccaaag ggaaacctcc cccaagcttt       660
     tcctggactc gtaatggaac tcactttgac atagacaagg accctctggt caccatgaag       720
     cctggctcag gaacccttgt catcaacatc atgagtgagg ggaaggcaga gacctatgaa       780
     ggagtctacc agtgcactgc aaggaacgag cgtggagctg ccgtctccaa taacattgtt       840
     gtccgcccat ctaggtcacc cttgtggacc aaggaaagac ttgaacctat agtactccag       900
     aatgggcagt cattagtact tccatgtagg cctccgattg gattacctcc ggccataata       960
     ttttggatgg ataattcctt tcagagactt ccacagagtg agcgggtttc ccaaggccta      1020
     aatggagacc tttacttctc caatgtcctc ccagaggaca cccgtgagga ctatatctgc      1080
     tatgccagat ttaatcacac tcaaaccatc cagcagaagc agcctatttc tttgaaggtg      1140
     atttcagtgg atgaattgaa tgacactata gctgctaatt tgagtgacac tgagttttat      1200
     ggtgctaaat ctagtaaaga gaggccccca acgtttctaa ctccagaggg caatgaaagc      1260
     cacaaagagg aattaagagg aaacgtgctt tcgctggagt gcattgcgga aggcctacct      1320
     actccaatta tttactggat caaagaagac ggaatgcttc ccgccaaccg gacattttat      1380
     cggaacttta agaaaaccct gcagatcact catgtttccg aagccgactc tggaaattat      1440
     cagtgcatag caaaaaacgc attaggagcc gtccatcaca ccatttctgt cactgttaaa      1500
     gcggctccct actggatcgt ggcacctcaa aacctcgtgc tttccccggg agagaatggg      1560
     accctcatct gcagagctaa tggcaacccg aaacccagaa ttagctggtt aacaaatgga      1620
     gtcccaatag aaattgctct cgatgacccc agcagaaaaa tagatggcga taccattata      1680
     ttttcaaatg ttcaagaaag ctcaagtgcg gtttatcagt gcaatgcctc taacaaatat      1740
     ggatatttac tagcaaatgc atttgtaaat gttctcgctg aaccacctcg gattctcaca      1800
     tcagcaaaca cactgtacca ggtcattgca aacaggcctg ctttgctaga ttgtgccttc      1860
     tttggatctc ctatgcctac cattgagtgg tttaaaggca ctaaaggaag cgctcttcat      1920
     gaagacattt atgttttgca tgataatgga acattagaaa ttcccgtggc ccaaaaggat      1980
     agtacaggga cgtatacttg tgtcgcacgg aataaactag ggatggcaaa gaatgaagtt      2040
     cacttggaaa tcaaagatcc aaccaggatc attaaacaac ctgagtatgc agtcgtccag      2100
     agggggagca aggtgtcctt tgaatgcaga gtgaaacatg accacacctt aatccccacc      2160
     attatgtggc tgaaggacaa tggagagctg cccaatgatg aaaggttctc cactgacaag      2220
     gatcatctgg tggtatctga tgtaaaggat gacgatggcg gaacctacac gtgtacggcc      2280
     aacacaacgc tggacagtgc ttcggccagc gctgtgctca gggttgtcgc tcctactcca      2340
     actccagccc ccatttacga tgtcccgaat cctccctttg atttagaatt gaccaatcaa      2400
     cttgacaaaa gtgttcagct gacatggacc ccaggcgacg acaacaatag ccccattaca      2460
     aaattcatca ttgagtatga agatgcaatg catgatgcag ggctgtggcg ccaccaggct      2520
     gaagtttctg gaacacagac cacagcccaa ctgaagctgt ctccctatgt gaactactcc      2580
     ttccgtgtca tggcagagaa cagcattggg agaagtatgc cgagcgaggc atccgagcag      2640
     tatcttacaa aagccgcaga accagatcag aatcccatgg ctgtggaagg actagggaca      2700
     gagccggaca acttggtgat tacatggaag cccctgaatg gttttcaatc gaatgggcct      2760
     ggcctccagt acaaagtgag ctggcgccag aaagatggtg acgatgagtg gacgtctgtg      2820
     gttgtggcca atgtatccaa atacattgtt tctggcacac caacctttgt cccatacctg      2880
     ataaaagttc aagctctgaa tgatgtgggg tttgcaccag agccagctgc agtcatgggg      2940
     cattctggag aagaccttcc aatggtggct cctggaaatg ttcgcgtcag cgtggtgaac      3000
     agtacgctgg cagaggtgca ctgggaccca gttcctccca agagtgtccg aggacactta      3060
     caaggctacc ggatttacta ctggaagacc cagagctcct ctaaaagaaa caggcgccac      3120
     attgagaaga agatcctcac cttccagggc accaagactc acggcatgct gccagggctg      3180
     cagccataca gtcactatgc cctcaacgtc cgagtggtca acgggaaagg ggagggccca      3240
     gccagcacgg acagaggctt ccatacaccg gagggagtcc ctagtgctcc ctcatctttg      3300
     aaaattgtta atcccacact ggactccctc actttggaat gggacccccc aagccaccca      3360
     aatggcatcc tgactgagta catcttacaa tatcagccaa ttaacagcac acatgagcta      3420
     ggccctctgg tagatttaaa aattcctgcc aacaagaccc gctggacttt gaaaaattta      3480
     aatttcagca ctcggtacaa gttctatttc tatgcacaga catcagtggg gccaggcagt      3540
     cagatcacag aggaagcgat aacgactgtg gacgaagctg gtattcctcc acctgatgta      3600
     ggtgcaggca aaggcaaaga agaatggagg aaagaaattg taaatggttc tcgaagcttc      3660
     tttgggttaa agggtctaat gccaggaaca gcatacaaag ttcgagttgg tgctgagggg      3720
     gactctggtt ttgtgagttc agaggatgtg tttgagacag gaccagcaat ggcaagccgg      3780
     caagtggata tcgcgaccca aggctggttc ataggtctaa tgtgcgctgt tgctctcctc      3840
     atcttaattt tgctgattgt ttgcttcatc agaagaaaca aaggtggtaa atacccagtt      3900
     aaagaaaagg aggatgctca tgcagaccct gaaatccagc ccatgaagga agatgatggg      3960
     acgtttggag aatacagtga tgcagaagat cacaagcctt tgaaaaaagg aagtcgaaca      4020
     ccttcagaca ggactgtgaa aaaagaagat agcgatgata gtctggttga ctatggagag      4080
     ggggtgaacg gccaattcaa cgaggatggc tcctttattg gccaatacag tggtaagaaa      4140
     gagaaagagc cagcagaggg aaatgaaagc tcagaggccc cttctcctgt caacgcaatg      4200
     aactcctttg tttaagtctt taagctctgt gccaatgtct aatctctctg gaatggtttt      4260
     cctgaacacc tgtcatccct ctcatactac ggacatatgg gtagaaagaa tgttttctgc      4320
     ggtatatgag tattatgaga ccagagcaag aacatgactc agtcaaatga tacattaata      4380
     tgaactgggg tgcaaagtgc atacgttttt gttcagagtg gggtttttct caatttcctt      4440
     ggaactgatt aaaaagaaat acaacatcaa aaaaaaaaaa aaaaaa                     4486
//