spacer

EBI Dbfetch

ID   AJ537425; SV 1; linear; mRNA; STD; MUS; 3532 BP.
XX
AC   AJ537425;
XX
DT   17-JAN-2004 (Rel. 78, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for growth differentiation factor 16 (GDF16 gene)
XX
KW   GDF16 gene; growth differentiation factor 16.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3532
RA   Guo J.H.;
RT   ;
RL   Submitted (17-JAN-2003) to the INSDC.
RL   Guo J.H., School of Life Sciences, Institute of Genetics, Fudan University,
RL   Handan Rd 220, Shanghai 200433, CHINA.
XX
RN   [2]
RA   Guo J.H.;
RT   "Cloning of human GDF16 and functional assocatied analysis";
RL   Unpublished.
XX
DR   MD5; 76efaa2b2cc662c70f521113a147ddbf.
DR   Ensembl-Gn; ENSMUSG00000051279; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057613; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3532
FT                   /organism="Mus musculus"
FT                   /strain="Kunming"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             107..1471
FT                   /gene="GDF16"
FT                   /product="growth differentiation factor 16"
FT                   /db_xref="GOA:P43028"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR002405"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:95689"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43028"
FT                   /protein_id="CAD60935.1"
FT                   /translation="MDTPRVLLWAIFLISFLWDLPGFQQASISSSSSSSTELDSTKDVG
FT                   NRKEGKMQRTPQESAEGRTPPEHGLRQKDLRRRPPGQHQGQEPPGRGLRVVPHEYMLSI
FT                   YKTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSTLSDKEE
FT                   LVGAELRLYRQAPPTPWGLPARPLHLQLFPCLSPLLLDARTLDPQGPTQAGWEVFDVWQ
FT                   GLRPQPWKQLCLELRAAWGELDAGDTGARARGPQQPPPLDLRSLGFGRRVRPPQERALL
FT                   VVFTRSQRKNLFTEMHEQLGSAEAAGAEGSWPAPSGSPDAGSWLPSPGRRRRRTAFASR
FT                   HGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNH
FT                   AIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR"
XX
SQ   Sequence 3532 BP; 843 A; 889 C; 963 G; 837 T; 0 other;
     gaggagcgcg gcccccgccg ctgtccagcc gctccgtgcc tttcgcgccc ggcgcagccg        60
     ctgctgtcgc cgccgcctct ccgagtaact tagccactcg ctcgccatgg acactcctag       120
     ggtccttctc tgggcgatct tcctcattag cttcctctgg gatttgccgg gtttccagca       180
     ggcttccatc tcctcgtcct cctcctcctc caccgaattg gactccacca aagacgtggg       240
     gaaccgcaaa gaagggaaga tgcagcgaac tccacaagag agtgccgagg gccggacgcc       300
     cccggagcac gggctgcggc agaaggacct ccggcggcgg ccgcccggac aacatcaggg       360
     gcaggagccg ccgggcaggg ggctgcgcgt ggtgcctcac gagtacatgc tgtcaatcta       420
     caagacttac tccattgccg agaagctggg catcaatgcc agctttttcc agtcttccaa       480
     gtcagctaat acgatcacta gctttgtaga cagaggactg gacgatctct cgcacactcc       540
     tctccggaga cagaagtatt tgtttgatgt gtccacactc tcagacaaag aagagctggt       600
     gggcgcagag ctaaggcttt atcgccaggc gcccccaacg ccctgggggc taccggcccg       660
     accgctgcac ttgcagctct tcccttgttt atccccattg ctactggacg ccaggaccct       720
     ggatcctcag ggaccaaccc aggccggctg ggaagtcttc gacgtgtggc agggcctgcg       780
     ccctcagcct tggaagcagc tgtgcctgga gttgcgggca gcctggggtg agctggacgc       840
     cggggatacg ggggcgcgcg cgaggggtcc ccagcagcca ccgcctctgg acctgcggag       900
     tctgggcttc ggtcggaggg tgaggccgcc ccaggagcgc gccctgcttg tagtgttcac       960
     cagatcgcag cgcaagaacc tgttcactga gatgcatgag cagctgggct ctgcagaggc      1020
     tgcgggagcc gaggggtcat ggccagcgcc gtcgggctcc ccagacgccg ggtcttggct      1080
     gccctcgccc ggccgccggc ggcgacgcac cgccttcgcc agccgtcacg gcaagcgaca      1140
     tggcaagaag tccaggctgc gctgcagcag aaagcctctg cacgtgaatt ttaaggagtt      1200
     aggctgggac gactggatta tcgcgcccct agagtacgag gcctatcact gcgagggcgt      1260
     gtgcgacttt ccgctgcgct cgcaccttga gcccactaac catgccatca ttcagacgct      1320
     gatgaactcc atggacccgg gctccacccc gcctagctgc tgcgttccca ccaaactgac      1380
     tcccattagc atcctgtaca tcgacgcggg caataatgta gtctacaagc agtatgagga      1440
     catggtggtg gagtcctgcg gctgtaggta gcggtgctgt cccgccacct gggccaggga      1500
     ccatggaggg aggcctgact gccgagaaag gagcaggagc tggcttggaa gaggccacag      1560
     gtgggggaca gcctgaaagt aggagcacag taagaagcag cccagccttc ccagaacctt      1620
     ccaaccccca acccagaagc agctaagggt ttcacacttt gccttgccag cctggaaaga      1680
     ctagacaaga aggattcttt cttttattat ggctttggtt ctttgtttgt tttgttttgt      1740
     tttatctcct tggttttgat aggacgtgga aggaggggaa atgcttatct gttcacaagt      1800
     gttctgtgga ttgggggagg agggaataag agaaataacc tattactttt gtccgcatct      1860
     cagattggtt gtttctacct gtgtaagaaa gtgaggcctt tgggtctttc tagccaagtc      1920
     tcagctggcg tccttgacct cacaggaagt atttgaccaa aggaataagt gagtcaggaa      1980
     gggtcttacc cttagagaag cccaagctgc ctccttctct gctctgtgca tccccacgaa      2040
     tttatcagtc tgtcctggtc tctcccagcg gagggaacag ggagttgcca ccgctgtggg      2100
     ctcagacctc cagatgcctt ttctgttggt ggtggggggg gggggggcag aaggatttgg      2160
     tatggatgga atgacaagaa ttagtccgtg tggaaccccg tgaaggataa tgagaaacca      2220
     caaggcctac ctctgaccgg gtgacacaga ggcgcattac ccaaggctgg ggtagcccac      2280
     ccaaaagctc ttggtcatgg atgtttctca gtggcttctt taaacagaat ttgccaaaat      2340
     cccagcatct ccttctaagg caattttttt ccctccttaa atggagaggg gtggaaactc      2400
     tataattaag gtaagaaggg aagaggagga ggaggaaaag acctgaaagg tggaagggct      2460
     acatcaggag gggagatgcg ggccccacaa gaggatggag ataaagggcc aggccccaag      2520
     catggaagga ggatgaaagg gccaggagtc tctgcctctg aagtttctta aaatttaagt      2580
     cccctctcct ctttctgaca ttcctgagag attaccagcc agcaatagcc cagggctccc      2640
     cctagagaaa cattttagat cgtaattacc agttaggtgc tgtttttaaa ccttagtaat      2700
     gaggagctgt gagtcgaggg ttacattgag tttggggtgg aaactggggt acaggggcac      2760
     caggaaagaa accagaagga agtaagagac agaacacggg aaatacctgt agtactccaa      2820
     atctccatcc tttcccacag tctgtaccat gattattttc aaacatcgcc tagacagagt      2880
     ctctttgaga agtaagcttc ctcatgtttg tccatggaac ggtttaaact gaggaccctg      2940
     agtgagtgat tacagactga tctgggttcc cccaactggt ttgctctctc tccccgctga      3000
     aatctgtttc ttgtctggtt cagagaagac aaactgtcaa ggaaacggtc ggaatgctaa      3060
     tactggtaat ataaactggt aagggagaaa agacaagact tggccaggag aaataactta      3120
     aatgcacatt tgctttggat gcactgctgt tctgttgagg ctgtatatat ttgtttattt      3180
     aagatgactg aaagtgcaaa gagaaaacat gcaattcatc ttaacgtaca aaacgttata      3240
     tgcactcaaa tgttataatt tctaatattt ttaaagttta tattcgagtt gtacaaagtt      3300
     aagcattaat cagatatttc attctttcat aatgttatca ttttcttaaa tattattaca      3360
     aaattttaag tgtgtctaat ggagagtttt ttttttgaaa ctgtctacct cactataata      3420
     cagattttga caacactaaa gttactggag gtcgattgat atacaaaaca tttttacagt      3480
     ataccttctt ggacgataag gaatctggtt aattctgtct tattaaactc at              3532
//


spacer
spacer