Dbfetch

ID   AJ507782; SV 1; linear; genomic DNA; STD; HUM; 227 BP.
XX
AC   AJ507782;
XX
DT   18-SEP-2002 (Rel. 73, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, DRB1*15new
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*15new allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-227
RA   Fischer G.F.;
RT   ;
RL   Submitted (11-SEP-2002) to the INSDC.
RL   Fischer G.F., Department for Blood Group Serology, University of Vienna,
RL   Waehringer Guertel 18-20, A-1090 Vienna, AUSTRIA.
XX
RN   [2]
RA   Fae I., Fischer G.F.;
RT   "A novel HLA-DRB1*15 allele";
RL   Unpublished.
XX
DR   MD5; 8ebe75f7d0fff9b4de8e5aabe43e9ef9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..227
FT                   /organism="Homo sapiens"
FT                   /isolate="SJ187/37"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>227
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q8HWN3"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWN3"
FT                   /protein_id="CAD47818.1"
FT                   /translation="CHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAE
FT                   YWNSQKDILEQARAAVDTYCRHNYGVVESFT"
FT   exon            <1..>227
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15new"
FT                   /number=2
XX
SQ   Sequence 227 BP; 47 A; 55 C; 84 G; 41 T; 0 other;
     tgtcatttct tcaatgggac ggagagggtg cggttcctgg acagatactt ctataaccag        60
     gaggagtccg tgcgcttcga cagcgacgtg ggggagttcc gggcggtgac ggagctgggg       120
     cggcctgacg ctgagtactg gaacagccag aaggacatcc tggagcaggc gcgggccgcg       180
     gtggacacct actgcagaca caactacggg gttgtggaga gcttcac                     227
//