Dbfetch

ID   AJ493663; SV 1; linear; mRNA; STD; MUS; 382 BP.
XX
AC   AJ493663;
XX
DT   19-SEP-2002 (Rel. 73, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus partial mRNA for divalent metal transporter (Slc11a2 gene), 5'
DE   splice variant 1A
XX
KW   alternative splicing; divalent metal transporter; Slc11a2 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-382
RA   Hubert N.H.;
RT   ;
RL   Submitted (08-JUL-2002) to the INSDC.
RL   Hubert N.H., Gene Expression Programme, European Molecular Biology
RL   Laboratory, Meyerhofstrasse 1, D-69117 Heidelberg, GERMANY.
XX
RN   [2]
RX   DOI; 10.1073/pnas.192423399.
RX   PUBMED; 12209011.
RA   Hubert N., Hentze M.W.;
RT   "Previously uncharacterized isoforms of divalent metal transporter (DMT)-1:
RT   implications for regulation and cellular function";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(19):12345-12350(2002).
XX
DR   MD5; 5fee2f2fa9ce56787bfdad8a4ed242bc.
DR   Ensembl-Gn; ENSMUSG00000023030; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022350; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022312; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022288; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022316; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022086; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022764; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021611; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022055; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022182; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022161; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022253; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022182; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022778; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021350; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021661; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023774; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138843; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042605; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042569; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042533; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042560; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042296; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043045; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042396; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042210; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042361; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042326; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042432; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042304; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043083; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041978; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041686; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..382
FT                   /organism="Mus musculus"
FT                   /strain="C57"
FT                   /mol_type="mRNA"
FT                   /tissue_type="duodenum"
FT                   /db_xref="taxon:10090"
FT   CDS             60..>382
FT                   /gene="Slc11a2"
FT                   /product="divalent metal transporter"
FT                   /note="5' splice variant 1a"
FT                   /db_xref="GOA:P49282"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="MGI:MGI:1345279"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49282"
FT                   /protein_id="CAD38518.1"
FT                   /translation="MGKKQPRAAAAAPNCELKSYSKSTDPQVSTMVLDPEEKMPDDGAS
FT                   GDHGDSASLGAINPAYSNSSLPHSTGDSEEPFTTYFDEKIPIPEEEYSCFSFRGRSRGL
FT                   AFL"
XX
SQ   Sequence 382 BP; 90 A; 113 C; 93 G; 86 T; 0 other;
     gtactcctct gcatatatag aggctgcgct gctctgaaaa gccaaaccag tcctgcacca        60
     tggggaagaa gcagccaagg gcggcagcag ctgctcccaa ctgtgagcta aaatcctatt       120
     ctaagagcac agacccccag gtatctacca tggtgttgga tcctgaagaa aagatgccag       180
     acgatggcgc ttctggggac catggagact ctgccagcct tggcgccatc aaccctgcct       240
     acagcaactc ttccctccca cattccactg gagactctga ggagcccttc accacctact       300
     ttgatgagaa aatccccatt cctgaggagg agtactcctg ttttagcttt cgtgggcgtt       360
     cacggggcct ggctttctta tg                                                382
//