spacer

EBI Dbfetch

ID   AJ489296; SV 1; linear; mRNA; STD; MUS; 1788 BP.
XX
AC   AJ489296;
XX
DT   03-OCT-2002 (Rel. 73, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for P2X purinoceptor 7 (P2rx7 gene), strain C57BL/6
XX
KW   P2rx7 gene; P2X purinoceptor 7.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1788
RA   Haag F.;
RT   ;
RL   Submitted (04-JUN-2002) to the INSDC.
RL   Haag F., Institute for Immunology, University Hospital Hamburg-Eppendorf,
RL   Martinistr. 52, Hamburg, D-20246, GERMANY.
XX
RN   [2]
RA   Adriouch S., Dox C., Welge V., Seman M., Koch-Nolte F., Haag F.;
RT   "A natural P451L mutation in the cytoplasmic domain impairs the function of
RT   the mouse P2X7 receptor";
RL   Unpublished.
XX
DR   Ensembl-Gn; ENSMUSG00000029468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100737; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1788
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /cell_type="T-cell"
FT                   /tissue_type="lymph node"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1788
FT                   /gene="P2rx7"
FT                   /product="P2X purinoceptor 7"
FT                   /function="purinergic receptor"
FT                   /db_xref="GOA:Q8CHP4"
FT                   /db_xref="InterPro:IPR001429"
FT                   /db_xref="InterPro:IPR003050"
FT                   /db_xref="InterPro:IPR027309"
FT                   /db_xref="MGI:MGI:1339957"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CHP4"
FT                   /protein_id="CAD33538.1"
FT                   /translation="MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYISFAL
FT                   VSDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQGNSFFV
FT                   MTNYVKSEGQVQTLCPEYPRRGAQCSSDRRCKKGWMDPQSKGIQTGRCVPYDKTRKTCE
FT                   VSAWCPTEEEKEAPRPALLRSAENFTVLIKNNIHFPGHNYTTRNILPTMNGSCTFHKTW
FT                   DPQCSIFRLGDIFQEAGENFTEVAVQGGIMGIEIYWDCNLDSWSHHCRPRYSFRRLDDK
FT                   NTDESFVPGYNFRYAKYYKENNVEKRTLIKAFGIRFDILVFGTGGKFDIIQLVVYIGST
FT                   LSYFGLATVCIDLLINTYSSAFCRSGVYPYCKCCEPCTVNEYYYRKKCESIMEPKPTLK
FT                   YVSFVDEPHIRMVDQQLLGKSLQVVKGQEVPRPQMDFSDLSRLSLSLHDSPLTPGQSEE
FT                   IQLLHEEVAPKSGDSPSWCQCGNCLPSRLPEQRRALEELCCRRKPGRCITTSKLFHKLV
FT                   LSRDTLQLLLLYQDPLLVLGEEATNSRLRHRAYRCYATWRFGSQDMADFAILPSCCRWR
FT                   IRKEFPKTEGQYSGFKYPY"
XX
SQ   Sequence 1788 BP; 433 A; 485 C; 474 G; 396 T; 0 other;
     atgccggctt gctgcagctg gaacgatgtc ttgcagtatg agacaaacaa agtcacccgg        60
     atccagagca cgaattatgg caccgtcaag tgggtcttgc acatgatcgt cttttcctac       120
     attagctttg ctttggtgag cgataagctg taccagcgga aagagcctgt tatcagctcc       180
     gtgcacacca aggtcaaagg catagcagag gtgacggaga atgtcacaga gggtggggtg       240
     acgaagttag gacacagcat ctttgacact gcagactaca ccttcccttt gcaggggaac       300
     tcattctttg tcatgacaaa ctatgtcaag tcagaaggcc aagtgcagac gctgtgtcct       360
     gagtatccca ggcgcggtgc acagtgctct tctgaccggc gttgtaaaaa ggggtggatg       420
     gacccacaga gcaaaggaat ccagactggc aggtgtgttc catatgacaa gacaaggaag       480
     acctgtgaag tctctgcctg gtgtcctact gaggaggaga aagaagctcc ccgacctgca       540
     ctcttgagga gcgccgaaaa cttcaccgta ctcatcaaga ataatatcca cttccccggc       600
     cacaactata ccacgagaaa catcttgcca actatgaacg gctcttgtac ctttcacaag       660
     acttgggacc ctcagtgttc catcttccga ctaggggaca tcttccagga agcaggagag       720
     aactttacag aggtggcagt tcagggagga atcatgggta tcgagatcta ttgggattgc       780
     aacctagaca gctggtccca tcactgccga cccaggtaca gcttccgccg cctggatgac       840
     aagaacacgg atgagtcctt cgtccccggc tacaacttca gatatgccaa gtactataag       900
     gagaacaatg tggaaaagcg gacgttgatc aaagccttcg gcatccgttt tgacatcctg       960
     gttttcggca ctggaggaaa atttgacatc atccagctgg ttgtatacat tggatccacc      1020
     ctgtcctact ttggcttggc cactgtgtgc attgacttgc tcatcaacac atactccagt      1080
     gctttctgca ggtcgggggt ttacccctac tgtaagtgct gtgagccctg cacagtgaac      1140
     gagtattact acagaaagaa gtgtgagtcc atcatggaac ccaagccgac gttgaagtat      1200
     gtgtcctttg tcgacgagcc gcacattcgc atggtggacc agcagctgct tgggaaaagt      1260
     ctgcaagttg tcaaaggcca agaagttcca agaccccaga tggacttctc cgacctgtct      1320
     aggctgtccc tatctctcca cgactcaccc ctgactcctg gacaatctga ggaaattcag      1380
     ctgctccatg aagaggtggc ccctaagtcc ggggacagcc cgagttggtg ccagtgtgga      1440
     aattgcctcc cgtctcgcct accggagcaa cgcagggccc tggaggagct gtgctgccgg      1500
     aggaagccgg ggcggtgcat caccacctcc aagctcttcc ataagctcgt gctgtcccga      1560
     gacaccctgc agctcctcct gctttaccag gatcccttgc tggtgctggg ggaagaggcc      1620
     accaacagca ggctgcgaca ccgtgcttac aggtgctatg ccacctggcg cttcggctcc      1680
     caggacatgg ccgactttgc cattctgccc agctgttgcc gctggaggat ccggaaggag      1740
     ttccccaaga ccgaggggca gtacagtggc ttcaagtatc cctactga                   1788
//


spacer
spacer