Dbfetch

ID   AJ489247; SV 1; linear; genomic DNA; STD; MUS; 7088 BP.
XX
AC   AJ489247;
XX
DT   19-JUN-2002 (Rel. 72, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Mus musculus s1p4 gene for sphingosine-1-phosphate G protein coupled
DE   receptor and partial Gna15 gene for G protein alpha 15 subunit, exon 7
XX
KW   Edg6 gene; G protein alpha 15 subunit; Gna15 gene; lpC1 gene; s1p4 gene;
KW   sphingosine-1-phosphate G protein coupled receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7088
RA   Contos J.J.A.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Contos J.J.A., Pharmacology, University of California at San Diego, 9500
RL   Gilman Dr., CA, 92093-0636, USA.
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(02)03409-9.
RX   PUBMED; 12401211.
RA   Contos J.J.A., Ye X., Sah V.P., Chun J.;
RT   "Tandem genomic arrangement of a G protein (Gna15) and G protein-coupled
RT   receptor (s1p(4)/lp(C1)/Edg6) gene";
RL   FEBS Lett. 531(1):99-102(2002).
XX
DR   MD5; 098391f015748dd524bdc5cec5fe1c7a.
DR   Ensembl-Gn; ENSMUSG00000034792; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044199; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017562; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017540; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017501; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017502; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017325; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017956; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016892; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017297; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017403; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017397; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017474; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017423; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017997; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016673; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016952; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000043709; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053646; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026505; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0026474; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0026444; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026452; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026254; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026944; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025825; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026182; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0026308; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0026299; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0026415; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026295; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026982; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025532; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025779; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7088
FT                   /organism="Mus musculus"
FT                   /strain="129/Sv"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="Stratagene"
FT                   /clone="XN7.0"
FT                   /db_xref="taxon:10090"
FT   mRNA            <247..1045
FT                   /gene="Gna15"
FT                   /product="G protein alpha 15 subunit"
FT   exon            <247..1045
FT                   /gene="Gna15"
FT                   /number=7
FT   CDS             <247..473
FT                   /codon_start=3
FT                   /gene="Gna15"
FT                   /product="G protein alpha 15 subunit"
FT                   /function="signal transduction"
FT                   /db_xref="GOA:P30678"
FT                   /db_xref="InterPro:IPR000654"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:95770"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30678"
FT                   /protein_id="CAD33253.1"
FT                   /translation="PRRDAEAAKSFILDMYARVYASCAEPQDGGRKGSRARRFFAHFTC
FT                   ATDTQSVRSVFKDVRDSVLARYLDEINLL"
FT   regulatory      1017..1022
FT                   /gene="Gna15"
FT                   /regulatory_class="polyA_signal_sequence"
FT   mRNA            join(1832..1922,3311..5597)
FT                   /gene="s1p4"
FT                   /note="alternative gene names, Edg6 and lpC1"
FT   exon            1832..1922
FT                   /gene="s1p4"
FT                   /number=1
FT   intron          1923..3310
FT                   /gene="s1p4"
FT                   /number=1
FT   exon            3311..5597
FT                   /gene="s1p4"
FT                   /number=2
FT   CDS             3712..4872
FT                   /gene="s1p4"
FT                   /product="sphingosine-1-phosphate G protein coupled
FT                   receptor"
FT                   /function="signal transduction"
FT                   /note="s1p4 instead of Edg6, lpC1"
FT                   /db_xref="GOA:Q9Z0L1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR004061"
FT                   /db_xref="InterPro:IPR004064"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333809"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0L1"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAD33254.1"
FT                   /translation="MNISTWSTLVTPESCHRLAASGHSLLIVLHYNHSGRLASRGGSED
FT                   GGGLGMLRGPSVAAGCLVVLENAMVLAAIAIYMRSRRWVYYCLLNITLSDLLTGLAYVV
FT                   NVLLSGTRTFQLSPVHWFLREGLLFMALAASTFSLLFTAGEAFATMVRVAESGATKTSR
FT                   VYGCIGLCWLLAAILGLLPLLGWNCVCAFPRCSSLLPLYSKGYVLFCVVVFALILVAIL
FT                   SLYGAIFRVVRANGQKSPRPPARRKSRRLLNTVLMILVAFVVCWGPLFGLLLADIFGSN
FT                   VWAQEYLRGMDWILALAVFNSAINPLIYSFRSREVQRAVLAFLCCGCLWLGLRGPGDCL
FT                   TRITEAHSGASTTDSSLRPRDSFRTSRSLSFRMREPLSSISSVRST"
FT   regulatory      5576..5581
FT                   /gene="s1p4"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 7088 BP; 1526 A; 1881 C; 1894 G; 1785 T; 2 other;
     gatccccaga gctgtcacaa agacctgagt tgaatcccca gcactacaca aaccaggctt        60
     gatgccgctc acccatcatc cagctctgag gagatcaaga gttcaaagtc agccagggct       120
     acagactgac ctggagggca gcctgggcta tttagggaaa ccagggtaat cccgggctat       180
     gtagggagtt tgcggccagc ctgggctata aaagggagcc cactcaaccc ctctccctct       240
     ctgcaggacc ccggcgagac gcagaggccg ccaagagctt catcttggac atgtatgcgc       300
     gcgtgtacgc gagctgcgca gagccccagg acggtggcag gaaaggctcc cgcgcgcgcc       360
     gcttcttcgc acacttcacc tgtgccacgg acacgcaaag cgtccgcagc gtgttcaagg       420
     acgtgcggga ctcggtgctg gcccggtacc tggacgagat caacctgctg tgacgcggga       480
     cagggaaccc caagcgcgac gcggtcgtgg cgaggacata cctccccctg gtggccgcgc       540
     gtggaactgc aggtccagga gctgccaagt ggggaagcca gcccacaggg agagagtccc       600
     tgcttcctac tgggccccca agcccagctc ccctgtaatt tattccctcg cccttcttct       660
     agttgttgga gaaaggacat gagccgggtc tttaacccca gcactccgga ggcagaggca       720
     ggaggatttc tgtgagttcc aggaccatgt tttcaaaaac aaacaaaacc ggatagaact       780
     gtccgggacc ttgtgacttc ccaggggccc tgttcacatc ttcctgtggg gaccatttca       840
     tcttaccaaa ggggaaaccg aggtcggcaa gatggctggt gagagtgcct tgccaccaag       900
     cctgacaact ggacttcagg acctgttcag tggacagaga gagggagcgg agtcctagga       960
     gaagttctct atctcctcag gcgtgcatgg tggtgacaca cctacccaca cagataaata      1020
     aatgtaattt aaaaacaaac aatcagggaa ctgaggaaga gagaaatatc tcagctctca      1080
     ggcgctgagg caggaggatt gcaagtttca tgtcctaaat tacagctcag tgttctcact      1140
     gtgagtccgg cagggccagg gccagggtat tgactcacag agacaatgtc aaatctaggc      1200
     acagaatgga gtagggggtt ggagtgcttc ggagggtaaa atgcaggagt tgcaactgcc      1260
     ctgctcatca acaagcccca ggttcggtga gagacccagg gagcgactga agaaaacatc      1320
     acagactagg gtatagagct gagtcatctg cgcttgtgtt ttgtgtccct gtcacccagt      1380
     caccccacaa cccgcccatg ccttccaagc actggagtta gagatctggc tgttctcagg      1440
     agaatccaga tgcagagtaa gctgcacttt actaactgaa ctccctccag cttccttaga      1500
     catatctcct tacactgctg catagtactt cactctgaga cacagaatgg cttggtctgg      1560
     gtgctgggga tggcagccag agtcttagga attctaagct ggactctact gttgttttgt      1620
     gcctgccaac atttttgtgc ctgccaacat ttttgcatct acctgaagca tcccagagta      1680
     ttgtcttgta caagggccct ggtgctgtct tcagggtgca tttcgggcag ggagatggta      1740
     cttgcccagc ttggttacat actcaaagag caaagagctg ttcttttttg ggggtttggt      1800
     tttggtttgt tttattttgt ttttgttttt tgagacaggg tttctctgta tagctctggc      1860
     tgtcctggaa cttactctgt agaccaggct ggcctcgaac tcagaaatct gcctgccctt      1920
     gcctcccaag tgctgggatt aaagcgtgcg ccaccacgcc tggcgagagc tgttcttgaa      1980
     gactgactaa gtgcctgctg tggaggtcaa gtgttcgtaa tcttctgttc tgttatggtg      2040
     cctgcttcat accacatcag cttccatagc agctgcaggt gaccgttctg tctgcactca      2100
     ttctggggtg ctgtgctcag tcctccttca tgctgaaccc cagtactcac ttgaactcag      2160
     tgcatgaggc ccagtcatgg gcttggctgg agttggcctt tagtcagcac tatgttgtgt      2220
     ctgtgactat gttattcagg ctcagggttc attctgggat aaaggctcag tatagggtag      2280
     aggtttgggg agtcagtgca gaggggccct ggcagagttt gtgcactgtc tgacatcaag      2340
     tctcttcagg gtcatggcac agagtaagag ctgtgctcag gtagggttgg gctcagtgca      2400
     ggaaggggtg aggctgggat tggggctcag tgcagggaag gagctgagac tggggattgg      2460
     ggctcagtgc agggaagggg ttgaggctgg ggtcaaagca cagaacaatt gtgtaggctg      2520
     aggctgagtt ggcactgcca ggggagctac aggtgtcctt gcacattgat tagacacctg      2580
     ctgtttgctg tgtgttgaca agcactatga agcatcccta gtacaggcaa caaaatctta      2640
     ttaagcgcct tggtgtgtgc agatgacttt ttctttaata ggtgatttta agcacctact      2700
     atgtattggt ggcacatatt tattattatt attattatta ttattattat tattattagg      2760
     tatttgtatt ttttttttag acagggtgtc tctattatgt agcccaggct ggcctggaac      2820
     ttacagaggt cctcctgcct ctgccttcca agaactgata ctaatggcat gtgctgctac      2880
     acccaatgtg acacattttt taagcacctt ctgtgtacac acagcaaaca ctgattaagc      2940
     accagtgttc agttcagggg taaaggtgcc tgaggcaaag ctctaaggac ccacatggta      3000
     gaaggggaga atggactcct gtgagttgcc ctctgacccc agcacatgaa aggacacaca      3060
     cagtcaatca ataaatgtac aaaaattcta aaaagatatt aagcactgtt atgcatgggc      3120
     tggtactcga tcgtgtttgg atgacatgaa ttaagccttg gctggtgtat acaagtgaca      3180
     aacattctta tgacattctg tcttttcctt tttttttttt tttttggttt ttcgagacag      3240
     nnttctctgt gtagcctggt gtcctggact acttatagca gctgctcgac tcagaaatcg      3300
     ctcgctctcg ctatgcacgc tttctgtgta cagttgacaa atacttatta ggcacctgct      3360
     gtatatataa gcatacagtt ggaacagttg ggcacaaggg ggtgggcaga gggatcttgg      3420
     atgccaggct atgcccattg tccagtagtg actccccatc tagtgcttgc ctcccatcca      3480
     aagagggaaa tttggtcctg ggtggggtgc catgagagat catgctctct agctcagagc      3540
     ccccagagtc acacccacag ttgctcagga tgcccctccc tgccctggcc tcacccccac      3600
     ccactctggg gcaccttgag cataacagga aatttcaaac aacaggaaac ccaggccagg      3660
     cagtgactcc accctgcgga ggcctctctc agtctgtccc cgggggaggc catgaacatc      3720
     agtacctggt ccacgctggt gaccccagag tcctgccacc ggctggcagc cagcggccac      3780
     agcctcctca ttgtcctgca ctacaatcac agcggcaggc tggccagccg cgggggctct      3840
     gaggacggtg gagggctagg gatgctgagg gggccgtcgg tggccgcagg ttgcctggtg      3900
     gtgctggaga acgccatggt gctggccgcc atcgccatct acatgcggtc ccgccgctgg      3960
     gtgtactact gcctgctgaa catcacactg agtgacctgc tcacaggcct ggcctacgtg      4020
     gtcaacgtgc tgctgtcagg gactcgtacc ttccagctgt caccggtgca ctggttcctg      4080
     cgggagggcc tgctcttcat ggccttggcc gcatccacct tcagtctgct cttcacggcc      4140
     ggcgaggcct tcgccaccat ggtgcgggtg gctgagagtg gggccaccaa gaccagccgt      4200
     gtgtatggct gcatcggtct gtgctggcta ctggcagcta tcctgggcct gctgcccctg      4260
     ctgggctgga actgtgtgtg cgccttccca cgctgctcca gcctgctgcc cctctactcc      4320
     aagggctatg tgctcttttg tgtggtggtc ttcgccctca tcctagtggc tatcctgagc      4380
     ctctacgggg ccatctttag agtggtccga gccaatgggc agaagtctcc acgtcctcct      4440
     gcccgccgca agtcccgcag gctactcaac accgtgctga tgatcttggt ggcctttgtg      4500
     gtgtgctggg gtcccctgtt tggcctgctc ctggctgaca tctttggttc taatgtctgg      4560
     gcccaggagt acctgcgtgg catggactgg atcctggccc tggccgtgtt caactcagcc      4620
     attaatcctc tcatctactc cttccgcagc cgtgaggtgc agcgcgctgt gctggccttc      4680
     ctgtgctgcg gctgtctctg gctaggtctg cgaggtccag gagactgcct gacccggatc      4740
     accgaggccc actccggtgc atccaccact gacagctccc tgaggcccag ggacagtttt      4800
     cggacttctc ggtcactcag cttcaggatg agagagccgc tgtccagcat ttccagcgtc      4860
     cgcagcacct agagcttgga ccagccagtt gcccactgag caggccctcc cagacgaggt      4920
     gagaagggac aggacacaag aaccttgcct gatggtgact gagaacatga cagcaagccc      4980
     cgggttcctt ccacaaaatt ccccgtgatg aatgtttggc agagagtggc tggagccagt      5040
     gagtctgggc cttgaagggc ccctccccgc cgcccaggca gcaaagggga tgtgccatgt      5100
     ccgaggccat ggacaggaca gagctttgtg gttctgtctt agtcacatgt gttcaggtca      5160
     atgcccaggc tactgtaatg tgtctcctgg tcatacccac tggtatacag tgctttgggg      5220
     gtgtgctggg atgggggtgg acctgcacca tttgtttgag ggcaacttga cgtgtttaag      5280
     aatgaaaggg ggcctggagg gcacaccagt ctgtcatcca cccctcttct caatgacttc      5340
     tacattggga caagcagcct gcccccgatg gcctccctcc tccagttcag gttctctgtc      5400
     tctgtgtggg gaggatagag ccacccactc caggtctggg gcaatctcaa ctggtcctgt      5460
     aaccccgcag cctcgccctt cctgttctga atcacggaga tatgctgtgg cagggagctg      5520
     tggaccctac catgtgatag tgcagctgca agccatgcat ggctgcataa aattcattaa      5580
     aatgaacgaa acctccacat tccgtttctc agtgtattgt aaccgaggcg cgctggcagt      5640
     gactctagga tggtagggat tgtcacagtt atagatggca gaagttcacg ctgttggaca      5700
     cacatcatct gttttctttt ctacactttc agtctgatgc tgtggctggt aatacgttgg      5760
     cagtatcact cacccgggga agaccacaag tttgagtctt agaatctgtt tcttacctaa      5820
     ggcaaatggt cttcagagaa ggcaccatcc ccaagtctcc acagcttcga aagccagcac      5880
     tcaccagtcg cgaatcttac tcaaagtcag ttcatgccag tttgcatatc aaattcccac      5940
     ctgtggctgc cagtgggtgg gtggcagtgt ctggtctttt atttcttatt tattgtattt      6000
     ctagaggtgt gagtgacata taattttaat tcacatctta acttacccca agacacaggg      6060
     actagtcaaa tccattgaag ttgcaatagg gcaaaccaaa aatgttaggt taaatatgtc      6120
     ccaagtatga acagggatac taaagacctc ccatcgtcac actagtctca ttttagctat      6180
     cttgatctcc ccactgccat taaagtccgc gccaattctt gccttcctac cttaccacct      6240
     gccccgaata ttattttttt aaccagcttt tcactcattc acttaaatcc tgtagaacac      6300
     ctgtagtcag agtgtcttgt gatcagagag ctagcccttc aagacaaagg cctcacctct      6360
     ctctctttct cttttatttt attttatttt attttctcgc attctaatcc cctctccttt      6420
     caaagactaa aagaacgact ctagttccca tattcctttg tgcttgcccg ataggactac      6480
     aattccagag aaacaaggca ccaggcgggc actttctctt tcctttccta catctttccg      6540
     ggtcgaacgg tcacgtcctg cactttaggt tttggattgt cctttcatta acgactccaa      6600
     acatggggct taaacaagat ttactgggaa tggtttttaa tagctttgta agtcatctgt      6660
     gttttgcggc ttggatgagt tcagtagcag tagattgtcc accatagctt ctaggagcgg      6720
     cacagtggga ctacaacttc caggggctcc gcgataagac tgtacagctt ccgagaggcc      6780
     ctagtgcgag tctaagtgtg cctacaactc caggttccac agtgtgtgga gccgtttaaa      6840
     acgaggctgc tcacaagaaa gactacattt cccagaaggc ggcgcggcag acagggccgt      6900
     ccgcagtgct gcccgaagga ccctagggca ggcgcgggct gttcgtggct ctccccgaag      6960
     gacctcagca gccgcccatg ccgagctgag tcgcccgagc ctcggccgct tcccgtcgcc      7020
     ctccgtcgct cgcgccttct ggcgctgccg ccgccgggat gttggaggaa gcgggcgagg      7080
     tgctcgag                                                               7088
//