spacer

EBI Dbfetch

ID   AJ457860; SV 1; linear; mRNA; STD; MUS; 1920 BP.
XX
AC   AJ457860;
XX
DT   23-APR-2002 (Rel. 71, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for serum albumin (alb gene)
XX
KW   alb gene; serum albumin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1920
RA   Hilger C.;
RT   ;
RL   Submitted (18-APR-2002) to the INSDC.
RL   Hilger C., Lab. of Immunogenetics and Allergology, CRP-Sante, 4 rue Barble,
RL   L-1210 Luxembourg, LUXEMBOURG.
XX
RN   [2]
RA   Le Pogam C., Hilger C., Hentges F.;
RT   "Mus musculus mRNA coding for serum albumin";
RL   Unpublished.
XX
DR   MD5; 227db3efa299e17c556b4d4fc0add7d8.
DR   Ensembl-Gn; ENSMUSG00000029368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031314; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1920
FT                   /organism="Mus musculus"
FT                   /strain="Balb/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1827
FT                   /gene="alb"
FT                   /product="serum albumin"
FT                   /db_xref="GOA:Q546G4"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87991"
FT                   /db_xref="UniProtKB/TrEMBL:Q546G4"
FT                   /protein_id="CAD29888.1"
FT                   /translation="MKWVTFLLLLFVSGSAFSRGVFRREAHKSEIAHRYNDLGEQHFKG
FT                   LVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESAANCDKSLHTLFGDKLCAIPNL
FT                   RENYGELADCCTKQEPERNECFLQHKDDNPSLPPFERPEAEAMCTSFKENPTTFMGHYL
FT                   HEVARRHPYFYAPELLYYAEQYNEILTQCCAEADKESCLTPKLDGVKEKALVSSVRQRM
FT                   KCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDLLECADDR
FT                   AELAKYMCENQATISSKLQTCCDKPLLKKAHCLSEVEHDTMPADLPAIAADFVEDQEVC
FT                   KNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLAKKYEATLEKCCAEANPPACYGTVLA
FT                   EFQPLVEEPKNLVKTNCDLYEKLGEYGFQNAILVRYTQKAPQVSTPTLVEAARNLGRVG
FT                   TKCCTLPEDQRLPCVEDYLSAILNRVCLLHEKTPVSEHVTKCCSGSLVERRPCFSALTV
FT                   DETYVPKEFKAETFTFHSDICTLPEKEKQIKKQTALAELVKHKPKATAEQLKTVMDDFA
FT                   QFLDTCCKAADKDTCFSTEGPNLVTRCKDALA"
FT   sig_peptide     1..54
FT                   /gene="alb"
FT   mat_peptide     73..1824
FT                   /gene="alb"
FT                   /product="serum albumin"
XX
SQ   Sequence 1920 BP; 529 A; 476 C; 463 G; 452 T; 0 other;
     atgaagtggg taacctttct cctcctcctc ttcgtctccg gctctgcttt ttccaggggt        60
     gtgtttcgcc gagaagcaca caagagtgag atcgcccatc ggtataatga tttgggagaa       120
     caacatttca aaggcctagt cctgattgcc ttttcccagt atctccagaa atgctcatac       180
     gatgagcatg ccaaattagt gcaggaagta acagactttg caaagacgtg tgttgccgat       240
     gagtctgccg ccaactgtga caaatccctt cacactcttt ttggagataa gttgtgtgcc       300
     attccaaacc tccgtgaaaa ctatggtgaa ctggctgact gctgtacaaa acaagagccc       360
     gaaagaaacg aatgtttcct gcaacacaaa gatgacaacc ccagcctgcc accatttgaa       420
     aggccagagg ctgaggccat gtgcacctcc tttaaggaaa acccaaccac ctttatggga       480
     cactatttgc atgaagttgc cagaagacat ccttatttct atgccccaga acttctttac       540
     tatgctgagc agtacaatga gattctgacc cagtgttgtg cagaggctga caaggaaagc       600
     tgcctgaccc cgaagcttga tggtgtgaag gagaaagcat tggtctcatc tgtccgtcag       660
     agaatgaagt gctccagtat gcagaagttt ggagagagag cttttaaagc atgggcagta       720
     gctcgtctga gccagacatt ccccaatgct gactttgcag aaatcaccaa attggcaaca       780
     gacctgacca aagtcaacaa ggagtgctgc catggtgacc tgctggaatg cgcagatgac       840
     agggcggaac ttgccaagta catgtgtgaa aaccaggcga ctatctccag caaactgcag       900
     acttgctgcg ataaaccact gttgaagaaa gcccactgtc ttagtgaggt ggagcatgac       960
     accatgcctg ctgatctgcc tgccattgct gctgattttg ttgaggacca ggaagtgtgc      1020
     aagaactatg ctgaggccaa ggatgtcttc ctgggcacgt tcttgtatga atattcaaga      1080
     agacaccctg attactctgt atccctgttg ctgagacttg ctaagaaata tgaagccact      1140
     ctggaaaagt gctgcgctga agccaatcct cccgcatgct acggcacagt gcttgctgaa      1200
     tttcagcctc ttgtagaaga gcctaagaac ttggtcaaaa ccaactgtga tctttacgag      1260
     aagcttggag aatatggatt ccaaaatgcc attctagttc gctacaccca gaaagcacct      1320
     caggtgtcaa ccccaactct cgtggaggct gcaagaaacc taggaagagt gggcaccaag      1380
     tgttgtacac ttcctgaaga tcagagactg ccttgtgtgg aggactatct gtctgcaatc      1440
     ctgaaccgtg tgtgtctgct gcatgagaag accccagtga gtgagcatgt taccaagtgc      1500
     tgtagtggat ccctggtgga aaggcggcca tgcttctctg ctctgacagt tgatgaaaca      1560
     tatgtcccca aagagtttaa agctgagacc ttcaccttcc actctgatat ctgcacactt      1620
     ccagagaagg agaagcagat taagaaacaa acggctcttg ctgagctggt gaagcacaag      1680
     cccaaggcta cagcggagca actgaagact gtcatggatg actttgcaca gttcctggat      1740
     acatgttgca aggctgctga caaggacacc tgcttctcga ctgagggtcc aaaccttgtc      1800
     actagatgca aagacgcctt agcctaaaca caccacaacc acaaccttct caggctaccc      1860
     tgacacatga aagggcgaat tccagcacac tggcggccgt tactagtgga tccgagctcg      1920
//


spacer
spacer