spacer

EBI Dbfetch

ID   AJ318863; SV 1; linear; mRNA; STD; MUS; 1182 BP.
XX
AC   AJ318863;
XX
DT   01-OCT-2001 (Rel. 69, Created)
DT   01-OCT-2001 (Rel. 69, Last updated, Version 1)
XX
DE   Mus musculus mRNA for putative G-protein coupled beta chemokine receptor
DE   (CCR11 gene)
XX
KW   CCR11 gene; G-protein coupled beta chemokine receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1182
RA   Biber K.P.H.;
RT   ;
RL   Submitted (09-AUG-2001) to the INSDC.
RL   Biber K.P.H., Medical Physiology, State University Groningen, Ant.
RL   Deusinglaan 1, 9713 AV Groningen, NETHERLANDS.
XX
RN   [2]
RA   Biber K.P.H.;
RT   "Cloning and characterisation of a new MCP-1 chemokine receptor CCR11";
RL   Unpublished.
XX
RN   [3]
RA   Zuurman M.W.;
RT   "LPS induced expression of a novel MCP chemokine receptor (CCR11) in mouse
RT   glial cells in vitro and in vivo";
RL   Unpublished.
XX
DR   MD5; beb2eb966da028b9dab0e89f8c54ae39.
DR   Ensembl-Gn; ENSMUSG00000043953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111888; mus_musculus.
DR   EuropePMC; PMC2662797; 19298652.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1182
FT                   /organism="Mus musculus"
FT                   /strain="CD-1"
FT                   /mol_type="mRNA"
FT                   /country="Netherlands"
FT                   /cell_line="microglial"
FT                   /db_xref="taxon:10090"
FT   CDS             59..1141
FT                   /gene="CCR11"
FT                   /product="putative G-protein coupled beta chemokine
FT                   receptor"
FT                   /db_xref="GOA:O35457"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1920904"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35457"
FT                   /protein_id="CAC79612.1"
FT                   /translation="MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQRVLQFCC
FT                   AVFAVGLLDNVLAVFILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPG
FT                   NGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMA
FT                   TALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLALPLLVFII
FT                   CCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYH
FT                   LDASVQVTQLAATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPR
FT                   EGHGRPIELYSNLHQRQDII"
XX
SQ   Sequence 1182 BP; 261 A; 324 C; 293 G; 304 T; 0 other;
     tatcaagcaa cctgcctcaa acgacgctgt tttggccggt gagcaaggac agcctccgat        60
     ggataactac acagtggccc cggacgatga atatgatgtc ctaatcttag acgactacct       120
     ggacaacagt gggccggacc aagttccggc ccccgagttc ctctcccccc agcgggtgct       180
     gcagttctgc tgcgcggtgt ttgcggtggg tctcttggac aacgtgctgg cggtgtttat       240
     cttggtgaaa tacaaaggac tcaagaatct ggggaacatc tacttcctaa acctggcact       300
     ttcaaacctg tgtttcctgc ttcccctgcc gttctgggcc catactgcag cacacgggga       360
     aagccctggc aacgggactt gtaaagttct tgtcggactc cactcctcgg gcttatacag       420
     cgaggtgttt tccaacatcc tcctccttgt gcaaggatac agggtgtttt cccaagggcg       480
     actggcctcc atcttcacga cagtgtcttg tggtattgtt gcgtgcatcc tggcatgggc       540
     catggctact gcgctctctt tgcccgagtc tgtgttttat gagcctcgga tggaaagaca       600
     gaaacacaag tgtgcctttg gcaaacctca cttcttgcca atcgaagcgc cgctctggaa       660
     gtacgttctg acgtcaaaaa tgatcatctt ggtacttgct cttcctctgc tggtttttat       720
     aatctgctgc aggcaactga ggagaaggca gagcttcagg gagagacagt acgacctcca       780
     caagccggct cttgtcataa cgggcgtgtt ccttttgatg tgggcgcctt acaacactgt       840
     gcttttcctg tctgctttcc aggaacactt gtccctgcag gatgagaaga gcagctacca       900
     cctggacgca agtgttcagg tcacacagct ggcagcgacc acccactgct gcgtcaaccc       960
     gctgctctat ttgcttcttg accggaaggc ctttatgaga taccttcgca gcctgttccc      1020
     acggtgcaat gatatcccct atcaaagtag tggaggctat cagcaagcgc ctccaaggga      1080
     aggtcatggc aggcccattg aactgtacag caatttgcat caaaggcagg atataatata      1140
     atataaacac tcaaccttgt ctcttcacat tgttttatgc ca                         1182
//


spacer
spacer