spacer

EBI Dbfetch

ID   AJ314651; SV 1; linear; genomic DNA; STD; MUS; 873 BP.
XX
AC   AJ314651;
XX
DT   02-FEB-2002 (Rel. 70, Created)
DT   31-JUL-2002 (Rel. 72, Last updated, Version 2)
XX
DE   Mus musculus Nat1 gene for arylamine N-acetyltransferase 1, strain CBA
XX
KW   arylamine N-acetyltransferase 1; NAT 1 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-873
RA   Boukouvala S.;
RT   ;
RL   Submitted (25-MAY-2001) to the INSDC.
RL   Boukouvala S., Department of Pharmacology, University of Oxford, Mansfield
RL   Road, Oxford, OX1 3QT, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1097/00008571-200207000-00006.
RX   PUBMED; 12142728.
RA   Boukouvala S., Price N., Sim E.;
RT   "Identification and functional characterization of novel polymorphisms
RT   associated with the genes for arylamine N-acetyltransferases in mice";
RL   Pharmacogenetics 12(5):385-394(2002).
XX
DR   MD5; 28988c3e88da4770ece839c174709bc7.
DR   Ensembl-Gn; ENSMUSG00000025588; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026677; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..873
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /map="B 3.1-3.3"
FT                   /strain="CBA"
FT                   /mol_type="genomic DNA"
FT                   /note="31 cM"
FT                   /db_xref="taxon:10090"
FT   CDS             1..873
FT                   /gene="Nat1"
FT                   /product="arylamine N-acetyltransferase 1"
FT                   /function="acetylation of arylamine and hydrazines"
FT                   /EC_number="2.3.1.5"
FT                   /db_xref="GOA:Q546L3"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="MGI:MGI:97279"
FT                   /db_xref="UniProtKB/TrEMBL:Q546L3"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC85410.1"
FT                   /translation="MDIEAYFERIGYKNSVNKLDLATLTEVLQHQMRAVPFENLNMHCG
FT                   EAMHLDLQDIFDHIVRKKRGGWCLQVNHLLYWALTKMGFETTMLGGYVYITPVSKYSSE
FT                   MVHLLVQVTISDRKYIVDSAYGGSYQMWEPLELTSGKDQPQVPAIFLLTEENGTWYLDQ
FT                   IRREQYVPNEEFVNSDLLEKNKYRKIYSFTLEPRVIEDFEYVNSYLQTSPASVFVSTSF
FT                   CSLQTSEGVHCLVGSTFTSRRFSYKDDVDLVEFKYVNEEEIEDVLKTAFGISLERKFVP
FT                   KHGELVFTI"
XX
SQ   Sequence 873 BP; 260 A; 163 C; 207 G; 243 T; 0 other;
     atggacatcg aagcatactt tgaaaggatt ggttacaaga actcagtgaa taaattggac        60
     ttagccacat taactgaagt tcttcagcac cagatgcgag cagttccttt tgagaatctt       120
     aacatgcatt gtggagaagc catgcatctg gatttacagg acatttttga ccacatagta       180
     aggaagaaga gaggtggatg gtgtctccag gttaatcatc tgctgtactg ggctctgacc       240
     aaaatgggct ttgaaaccac aatgttggga ggatatgttt acataactcc agtcagcaaa       300
     tatagcagtg aaatggtcca ccttctagta caggtgacca tcagtgacag gaagtacatt       360
     gtggattccg cctatggagg ctcctaccag atgtgggagc ctctggaatt aacatctggg       420
     aaggatcagc ctcaggtgcc tgccatcttc cttttgacag aggagaatgg aacctggtac       480
     ttggaccaaa tcagaagaga gcagtatgtt ccaaatgaag aatttgttaa ctcagacctc       540
     cttgaaaaga acaaatatcg aaaaatctac tcctttactc ttgagccccg agttatcgag       600
     gattttgaat atgtgaatag ctatcttcag acatcgccag catctgtgtt tgtaagcaca       660
     tcgttctgtt ccttgcagac ctcggaaggg gttcactgtt tagtgggctc cacctttaca       720
     agtaggagat tcagctataa ggacgatgta gatctggttg agtttaaata tgtgaatgag       780
     gaagaaatag aagatgtact gaaaaccgca tttggcattt ctttggagag aaagtttgtg       840
     cccaaacatg gtgaactagt ttttactatt tag                                    873
//


spacer
spacer