Dbfetch

ID   AJ306538; SV 1; linear; genomic DNA; STD; MUS; 2482 BP.
XX
AC   AJ306538;
XX
DT   22-MAR-2001 (Rel. 67, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus partial Gpr37l1 gene for orphan Gpr37-like protein 1, exon 2
XX
KW   Gpr37l1 gene; orphan G-protein coupled receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2482
RA   Marazziti D.;
RT   ;
RL   Submitted (19-MAR-2001) to the INSDC.
RL   Marazziti D., Meg, Istituto di Biologia Cellulare-CNR, Via Ramarini, 32,
RL   00016-Monterotondo Scalo (Roma), ITALY.
XX
RN   [3]
RA   Marazziti D., Golini E., Magrelli A., Matteoni R., Tocchini-Valentini G.P.;
RT   "Genomic analysis of GPR37 and related orphan G-protein coupled receptor
RT   genes highly expressed in the mammalian brain";
RL   Curr. Genomics 2:253-260(2001).
XX
DR   MD5; c29ed4543ab721aa26121624ee0f67ee.
DR   Ensembl-Gn; ENSMUSG00000026424; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016518; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016501; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016466; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016461; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016287; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016922; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015867; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016260; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016366; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016365; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016437; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016390; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016958; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015653; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015930; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027682; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022278; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022248; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0022216; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022220; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0022027; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022732; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021557; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0021966; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0022096; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0022109; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0022198; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0022080; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0022767; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021288; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021601; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2482
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /map="D1Mit31-D1Bir20"
FT                   /strain="BALB/c"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone="Phage1"
FT                   /tissue_lib="Clontech ML1030j genomic library"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   mRNA            1036..>2482
FT                   /gene="Gpr37l1"
FT   CDS             <1036..1851
FT                   /codon_start=1
FT                   /gene="Gpr37l1"
FT                   /product="orphan Gpr37-like protein 1"
FT                   /function="orphan G-protein coupled receptor"
FT                   /db_xref="GOA:Q99JG2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003909"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1928503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99JG2"
FT                   /protein_id="CAC34843.1"
FT                   /translation="VSSLGVTTFSLCALGIDRFHVATSTLPKVRPIERCQSILAKLAVI
FT                   WVGSMMLAVPELLLWQLAQEPAPTAGTVDSCIMKPSADLPESVYSLVMTYQNARMWWYF
FT                   GCYFCLPILFTVTCQLVTWRVRGPPGRKPECRAGRHEQCESQLNSTVVGLTVVYAFCTL
FT                   PENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCICRPLGQAFLDCCC
FT                   CCCCEECGGASDSSATVSADSKLKAEVSSSIYFHKPRESPPLLPLGTPC"
FT   exon            1036..>2482
FT                   /gene="Gpr37l1"
FT                   /number=2
FT   mat_peptide     <1036..1848
FT                   /gene="Gpr37l1"
FT                   /product="GPR37L1"
XX
SQ   Sequence 2482 BP; 485 A; 679 C; 622 G; 696 T; 0 other;
     ggctcaaccg ggaatgattt tcctgtgtgc tgatggacga acagtgtgaa gggacggtga        60
     gagcccaggc ctctctccag gagctgctcc ctgcatgtgg gactgcttag gacagtgtgg       120
     gcagggtgaa agcaagggag agtaggccaa gttccctggc acttaactca atggtctcac       180
     atgagaaggt acaggaagta gaaaaacctg caaaaaatcc taaatttgtc cattcattca       240
     ttcattcttt ttttttcccc tagctatcct ggaactcact gtgtagacca ggctggcctc       300
     aaactcagag actcacctgc ctctgagtct ttcagtgctg ggattaaagg tgtacgccac       360
     cactgctttc atctttcatt gttcttttgt tctttccctc ccttctttct ttccttcagt       420
     ctgttttgag acagggtctc atatatccca ggctagcctt gacctttttg tatggccaag       480
     gttggccttg aactcgtgat tctcctgcct ctggctttca agttctgggg tcccgtgtac       540
     atgccgtcac ttccaggcta agcccagaat ttttatgtct ttgtcctggt tcttccttag       600
     aggtgacgtc cagtgtctga gggacgtcag ggtctgtggg aggtaggtct agcagactct       660
     agtttgggaa gtggaaaaag gatcaagcaa tgcctatcta cctcagtttc tccattcatc       720
     catcacctgt gtggttgtgg acaagtcgct ttttctgcct gagcttccgt tccttctgta       780
     tgatggtaca tcatctgtat gaagtgctag gatcacactg tgtgtgtgtt gacactatgc       840
     aggaagacaa ttgagagtgt tgtgacatac agggagcgct ggatgggtag aaaattcttc       900
     accagtagca gttattatca tagctgctag tctctgttca ggtgtaactc gtgtttctat       960
     ttagcctgga ccaggatgtc gttgcctccg taatcattca actgagcact ctctcttcca      1020
     catccttgtt cacaggtctc ctccctggga gtcacaacct tcagtctctg tgccctgggc      1080
     atagaccgat tccatgtggc caccagcacc ctgccaaagg tgaggcccat tgagcgatgt      1140
     caatcaattc tggctaaact agctgtcatc tgggtgggct ccatgatgct ggccgtgccc      1200
     gaactcctgc tatggcagct ggcccaggag ccggctccca ccgcaggaac tgtggactcg      1260
     tgtatcatga aaccttcagc cgacctgccc gaatccgtct attcgctggt gatgacctac      1320
     cagaatgccc gcatgtggtg gtattttggt tgctacttct gtctgcccat cctcttcacc      1380
     gtcacctgtc agctggtgac gtggcgggtg cggggcccac caggcaggaa gcctgagtgt      1440
     agagcgggca ggcatgagca gtgtgagagc cagctcaaca gcaccgtggt cggcctgact      1500
     gtggtctatg ccttctgtac actccctgag aacgtctgca atatcgtggt ggcttacctc      1560
     tctaccgagc tcacgcggca gaccctggac ctcctgggcc tcatcaacca gttctccacc      1620
     ttctttaagg gcgccatcac ccctgtgctc ctcctgtgca tctgcaggcc actgggccag      1680
     gcctttctgg attgctgctg ctgctgctgc tgcgaggagt gcggcggggc ctcagactcc      1740
     tcagccacag tcagcgcgga cagcaagctg aaggcggaag tgtcctcttc tatctacttc      1800
     cacaagccca gggagtcgcc cccactcctg cccctgggca ccccttgctg agtctatggg      1860
     ggatctggag caggtgcaga gccggcgggg gaggggtgcc atcccggtcc atgatggtct      1920
     gctgattctt tgacacggtc tcactttgac ccctctctca tcttgctgtt tagagatgga      1980
     cttggctcat cttgtcaaag tctgggcttt tcaaagctcc atctacaaac aatgctgttc      2040
     ttatcctccg aggggcctgc cagatctcca cctccttgta gatggagatc tgtctaggtc      2100
     attagagttg cccagaatct caatctggcc accctagagc cagggcttgg ccttttgcct      2160
     attctccctt tggtcttagg atctgactat tggctgagcc tgtccatcat gatggattgt      2220
     gtgctggtga gctccaacat catttctact cctacctagc ctcctatact ggactaggga      2280
     cttctagggg gctaacctaa ccaagccctg gactccactt tctaaagtgg gtctgtctta      2340
     gccctgcatg tgttttccct tttccccaga gcattctctc actctgtctt ccgttctcag      2400
     aggttatcag ttgcattgtt cccgttaggt gcttttctgt agaaggccat tctggaaaaa      2460
     acaataaagt aggtaccaca aa                                               2482
//