Dbfetch

ID   AJ297390; SV 1; linear; mRNA; STD; MUS; 3995 BP.
XX
AC   AJ297390;
XX
DT   29-AUG-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for twisted gastrulation protein (tsg gene)
XX
KW   tsg gene; twisted gastrulation protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3995
RA   Graf D.;
RT   ;
RL   Submitted (30-JUN-2000) to the INSDC.
RL   Graf D., Lymphocyte Development Group, MRC Clinical Sciences Centre,
RL   Imperial College School of Medicine, Hammersmith Hospital, Du Cane Road,
RL   London, W12 ONN, UNITED KINGDOM.
XX
RN   [2]
RA   Graf D., Timmons P.M., Hitchins M., Episkopou V., Moore G., Ito T.,
RA   Fujiyama A., Fisher A.G., Merkenschlager M.;
RT   "Evolutionary conservation, developmental expression, and genomic mapping
RT   of mammalian Twisted gastrulation";
RL   Mamm. Genome 124:554-560(2001).
XX
DR   MD5; 895f188367660fa274b01bcfa7640c98.
DR   Ensembl-Gn; ENSMUSG00000024098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024906; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3995
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             109..777
FT                   /gene="tsg"
FT                   /product="twisted gastrulation protein"
FT                   /function="putative modifier of BMP-signalling"
FT                   /db_xref="GOA:Q9EP52"
FT                   /db_xref="InterPro:IPR006761"
FT                   /db_xref="MGI:MGI:2137520"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EP52"
FT                   /protein_id="CAC05586.1"
FT                   /translation="MKSHYIVLALASLTFLLCLPVSQSCNKALCASDVSKCLIQELCQC
FT                   RPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFR
FT                   ALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKE
FT                   RMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
FT                   "
FT   sig_peptide     109..180
FT                   /gene="tsg"
FT   mat_peptide     181..774
FT                   /gene="tsg"
FT                   /product="twisted gastrulation protein"
FT   regulatory      3374..3379
FT                   /gene="tsg"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 3995 BP; 1062 A; 874 C; 903 G; 1156 T; 0 other;
     acgcgtccgc gcggcgccgg ggttcgcggg agctgcttgg aggctcggcg gcgggagagg        60
     ccggggccac gcttcttgga agctactgag tgacttcttt gaagaaccat gaagtcacac       120
     tatattgtgc tagctctagc ctccctgacg ttcctgctgt gtctccccgt gtcccagagc       180
     tgtaacaaag cactctgtgc cagcgatgtg agcaaatgcc tcattcagga gctctgccag       240
     tgccggcctg gagaagggaa ctgcccctgc tgtaaggagt gcatgctgtg cctcggggcc       300
     ctgtgggacg agtgctgcga ctgtgtcggt atgtgcaacc ctcggaatta cagcgacacc       360
     ccgcccacat ccaagagcac cgtggaggag ctgcacgagc ccattccgtc cctgttcagg       420
     gcgctgacgg agggcgacac ccagctgaac tggaacatcg tctccttccc tgtggcagag       480
     gagctgtcac accatgaaaa cctagtctcc ttcctagaaa ctgtgaacca gctgcaccac       540
     caaaacgtgt ctgttcccag caacaatgtc cacgccccct tccccagcga caaagagcgc       600
     atgtgcacag tggtttactt tgatgactgc atgtccatcc accagtgtaa gatatcctgc       660
     gaatccatgg gtgcatccaa gtatcgctgg tttcacaacg cctgctgcga gtgcatcggt       720
     ccagagtgca ttgactatgg gagtaaaact gtcaagtgta tgaactgcat gttttaaaga       780
     gggggaagaa atgcaaacca aagcagtaag tcatgaagtg tgcagaaatc ttggttctgg       840
     tatgctagga gtgtgttaag ttatatgatt gtaactgtgc tttttatatc tggtgcctat       900
     tagtgtaggt cttttccatt ggattcaatg gaactttagt cacatgagga tcgggagttc       960
     agaggagtcc tgggaaaacc tgacatgctg acagaaggtg ccgtcttctt ccagctttcc      1020
     aaacacttct cgttttgaac gtgatagcac aagcctggta catgtgtggt tctcacctgc      1080
     cagttgtaga cactaggtcc ctatagtcac acatctctta attgtgcctt ggctggctta      1140
     cctgttttgt atgagtaaat attacagttt ataattctaa caactcacat tcaagccatg      1200
     ctgaaactta atttcaaacc actttacatt ggttttagaa agtaaatatt tactatattt      1260
     tacaacagaa gagtttgcct agggccagcg agctgactca gtggataaag gcgcttgcta      1320
     ccaagcctga taacctgagt tccatcccca gagcccgtac agtggaagga caggaccagc      1380
     tgctgggagt tgtcctctga cctccagaca ggcacagtat catgcgtgga ggtgtgcttg      1440
     tgtgtgcaca cacataacta actgttttta aaaatataaa cctcttacat ggtgaaatct      1500
     aaatctgtcg tgtagctctc acactgacag tggtttggat gttatgtccc ctgtccgcct      1560
     gtagtgctgg tgtggtgaga cacagagtcg tcactgctct ggtatagaag agttttgtct      1620
     accaagagtg tcatggcata cctttggaac ttcatcaaat gcacttgagg atgacctggg      1680
     tcaggaagta gccaggtaaa agcagcggga ctgtaggcga tgctccatta gactccgtgc      1740
     agagcagcag gtgcacagca tagctgggtg tgcggctgac caggagaggg tctgactccg      1800
     caccagcaga acagcagggt ctccagcacg tgtgggaagc acgtgggaga gggttgagga      1860
     aggatgcaca gatgtggaca gagaagcata aaaatgtcgg gaactcctag tagggtccac      1920
     cttaaaatcg ctttatagtc tctggctttg ttactctgta agattacact tgtttctgga      1980
     tatctgaatc caaataagca tcatatttta agaagctctg tttctgaact tccaggggga      2040
     aatctgttta atgtgtttac tcctagcata ctacagaatt ttctagctct atagcttctt      2100
     acctagcgtt tccatagtgc tgagcttcat tactacacgc ccttcctagt aataaaattc      2160
     tcaccttcaa gcatgaatca aaaacaaata tctataatac acaggttcaa ttttatagaa      2220
     ttgctatttt ttttagtcca tatctcatta aaagtaactt tttaggaata atctttatat      2280
     gggtacatat tttggtacat aaaatagaaa atgttcttaa actcattttg tattatttga      2340
     atagttacaa gatgatttgt ggtatcatgg gtacccatta taaaccatgc tcttcccagt      2400
     agctgacgaa ctcaaggtat cacagccttc taagaagccg acttagaaac atggctgtac      2460
     atgaatatta tacattaagg tgtcctctca cttctaccca gagtgcctct gttcaaaggt      2520
     gccttggaaa catttcagcc ccttccttct tagctcccac agggctgtgg gtgttcttga      2580
     aatcaggagg cgttttgaag gaccacagct gctccatttc agccgctgat tcttaggaaa      2640
     gttcatgctc tgacagaagt gtgctttgat ggcttctagc ggtgcatctc gtctcgtttt      2700
     ctttgtttgt ttttgttgtt gctatcatgg tttggtttgg ttttgagaca ggatctctgt      2760
     gcagccctgg ctggcctgga atgtactatg tagaccaggc tggctctcct catgttttct      2820
     tagtgatggc cataaacatt gttaaaatac atcaccatct tttaaaaact tttcattatt      2880
     aaaatttaaa atatagcatg tcattttttt accccataca tttgctatga aaaatttttt      2940
     aaaccacctg ctttaacttt tttattgccc tgtttttcct attagaattg atccccactg      3000
     aggtaaattt tataatcatg ttttgtgtat ttttcctggc tcgccaaggc ttatgaagaa      3060
     atagcagcca ttccctgaca ggtttgcgct cccaccacag agaggctgag caagatgatc      3120
     agaggatcaa ggccagccag agcaaggcac tgcccagaaa gcacaagtcc tgtgctcagc      3180
     gttttgcgta cggttttatt cctaattgaa atgtaatatt tcagaagcta gcagcctcgc      3240
     tcagtctaga ccttccacac caatctagca gcgattctcc cgtactaaag cctttgtaag      3300
     agtttacggt tcttcctcag tgaaaaatga tcttgttttt cttacagccg gatccaaaga      3360
     cgctagatgt taagggctga ggctgaagcc cggtgacggg cgctcacctg tcatggtgca      3420
     gccctcgttc caccgtgagc accagcaaga gacaaacaca agcttgtgag tcagaggccg      3480
     ttattaaatt catacgcaca tactccctat agcgagacat gggcttatgg gcaggctttt      3540
     ttttcataac atttatgaga aaacaatgtt ttccccataa catttaatta ggactgtagc      3600
     ttattggtaa ttaaggtaca aaatcaaagt cgagtagaat gtactgttca cacagcgtgt      3660
     tgtgaaaggg gtcctcacac caaagtttaa ctgtaaagtt tagaaaaata acattgtcat      3720
     tagcatattt gaacacatat ttggaatttc taaaaagcat caaaatagaa aaagaaagtg      3780
     aaactctgga gaatgagatg ctgaagatgg gctatgattt aaaggtctgt tctgtagtta      3840
     gaaagcacct tttaaagact ttgttcattc ccaagagtct atgttgattg catttaacat      3900
     gaccgacaac ttatatatgt aattgtgtac attttcattg gttgtctctg tagtccaaaa      3960
     gaaggtattt taataaaaaa tagaaatgac tgtgt                                 3995
//