Dbfetch

ID   AJ295702; SV 1; linear; genomic DNA; STD; MUS; 780 BP.
XX
AC   AJ295702;
XX
DT   30-JUL-2000 (Rel. 64, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Mus musculus partial Fas/ApoI gene, exon 1 and join CDS
XX
KW   Fas/ApoI gene; Fas/ApoI protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-780
RA   Koczan D.;
RT   ;
RL   Submitted (27-JUL-2000) to the INSDC.
RL   Koczan D., Institute of Immunology, University of Rostock, Schillingallee
RL   70, 18057 Rostock, GERMANY.
XX
RN   [2]
RA   Koczan D., Ibrahim S.M., Thiesen H.J.;
RT   "Role of a mutant fas receptor in a transgenic mouse.";
RL   Unpublished.
XX
DR   MD5; 7e2bae4cd9ffe6d6d6d35ef824678c98.
DR   Ensembl-Gn; ENSMUSG00000024778; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025056; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025034; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025000; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025030; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024789; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025471; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024766; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024898; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024859; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024984; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024890; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025529; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024323; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025691; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0051587; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0051530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051529; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051260; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052016; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051395; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0051202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0051307; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0051262; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0051426; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051259; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052145; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050544; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..780
FT                   /organism="Mus musculus"
FT                   /strain="129/Sv"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(261..339,AJ295703.1:1..154,AJ295704.1:3872..4009,
FT                   AJ295704.1:5262..5370,AJ295704.1:7284..7345,
FT                   AJ295704.1:7477..7530,AJ295704.1:8004..8083,
FT                   AJ295704.1:9255..9279,AJ295704.1:13393..14170)
FT                   /gene="Fas/ApoI"
FT   exon            261..339
FT                   /gene="Fas/ApoI"
FT                   /number=1
FT   CDS             join(310..339,AJ295703.1:1..154,AJ295704.1:3872..4009,
FT                   AJ295704.1:5262..5370,AJ295704.1:7284..7345,
FT                   AJ295704.1:7477..7530,AJ295704.1:8004..8083,
FT                   AJ295704.1:9255..9279,AJ295704.1:13393..13724)
FT                   /gene="Fas/ApoI"
FT                   /product="Fas/ApoI protein"
FT                   /function="apoptotic pathway"
FT                   /db_xref="GOA:P25446"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR008063"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR033998"
FT                   /db_xref="InterPro:IPR033999"
FT                   /db_xref="MGI:MGI:95484"
FT                   /db_xref="PDB:2NA6"
FT                   /db_xref="PDB:3OQ9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25446"
FT                   /protein_id="CAC00638.1"
FT                   /translation="MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVHETDKNCS
FT                   EGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCD
FT                   EEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRK
FT                   QSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLS
FT                   KYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSD
FT                   AYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE"
XX
SQ   Sequence 780 BP; 161 A; 199 C; 240 G; 180 T; 0 other;
     ccgcccccca cccccacccc gctcaggccg cctgtgcagt ggtgagtcag tgggtttccc        60
     cgggagacca gcagaacttt ctcgcaaccc ttggggcttt acgaagattg tgtttggtcc       120
     ctcaaaagaa aaaaagtgac atacacgtgt tcaaagcgat ttctgggaag acctgaatag       180
     gagcgaagcg gtttgtgcgt gccagggggc gggcctaggc aaagtacata cccacaggca       240
     gtctagagct ggtgggtggg gccgcaggct gcccacacag gccgcccgct gttttccctt       300
     gctgcagaca tgctgtggat ctgggctgtc ctgcctctgg taagctttgg gacgcctggg       360
     atgtgggacg ctgcatactg gggaccacca catgagattc cagatgtggc tggcattggg       420
     tgccaccggt ccagatgttt agaaacgcag gggagctcgc tttcgctgtt ggctaagtgc       480
     tcagggctga agcccaagtc cagcgttttc tggaaaaagt ttgggtcggg gcggggggcg       540
     ggggcgacgg tcagagcttg gtgctggcca gctcttggat cagatcgctt tagtatggct       600
     ggagagggac tctggcttat agacttgccc agacactttt ctagtgccac tttagggcac       660
     tagaaaagtt cgctccgagg ctccctggca tttgacactt ctgacagttc gctcaaccgg       720
     gaagtgagtt actctgggct gtatttacaa gccaagcatt agatcataaa atttctcaaa       780
//