spacer

EBI Dbfetch

ID   AJ293294; SV 1; linear; mRNA; STD; HUM; 2258 BP.
XX
AC   AJ293294;
XX
DT   03-DEC-2000 (Rel. 66, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens mRNA for sphingosine-1-phosphatase (ORF1)
XX
KW   sphingosine-1-phosphatase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2258
RA   Van Veldhoven P.P.;
RT   ;
RL   Submitted (07-SEP-2000) to the INSDC.
RL   Van Veldhoven P.P., Farmakologie, K.U.Leuven, Herestraat, B-3000 Leuven,
RL   BELGIUM.
XX
RN   [2]
RA   Van Veldhoven P.P.;
RT   "CLoning of human sphingosine-1-phosphatase";
RL   Unpublished.
XX
DR   MD5; 9c80beff62119e9ee771ce119a3ffa19.
DR   Ensembl-Gn; ENSG00000126821; homo_sapiens.
DR   Ensembl-Tr; ENST00000247225; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2258
FT                   /organism="Homo sapiens"
FT                   /chromosome="14"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             33..1358
FT                   /product="sphingosine-1-phosphatase"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q9BX95"
FT                   /db_xref="H-InvDB:HIT000246614.12"
FT                   /db_xref="HGNC:HGNC:17720"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9BX95"
FT                   /protein_id="CAC17772.1"
FT                   /translation="MSLRQRLAQLVGRLQDPQKVARFQRLCGVEAPPRRSADRREDEKA
FT                   EAPLAGDPRLRGRQPGAPGGPQPPGSDRNQCPAKPDGGGAPNGVRNGLAAELGPASPRR
FT                   AGALRRNSLTGEEGQLARVSNWPLYCLFCFGTELGNELFYILFFPFWIWNLDPLVGRRL
FT                   VVIWVLVMYLGQCTKDIIRWPRPASPPVVKLEVFYNSEYSMPSTHAMSGTAIPISMVLL
FT                   TYGRWQYPLIYGLILIPCWCSLVCLSRIYMGMHSILDIIAGFLYTILILAVFYPFVDLI
FT                   DNFNQTHKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVTYNMG
FT                   LVLDPSLDTLPLAGPPITVTLFGKAILRILIGMVFVLIIRDVMKKITIPLACKIFNIPC
FT                   DDIRKARQHMEVELPYRYITYGMVGFSITFFVPYIFFFIGIS"
XX
SQ   Sequence 2258 BP; 565 A; 499 C; 508 G; 686 T; 0 other;
     cgccggcccg ccttcccggg ggttccgtta tcatgtcgct gaggcagcgc ctggcccagc        60
     tggttggccg tctgcaggac ccgcagaaag tggcccgttt ccagcggctg tgcggggtgg       120
     aagcgccgcc gcgccgctca gcagaccgga gggaggatga gaaagcggag gcgcctctcg       180
     ccggagaccc tcgactgcga gggcggcagc caggggcgcc tggaggcccc cagcctcccg       240
     ggagcgaccg caatcagtgc ccggccaagc cggacggcgg cggcgccccc aacggcgtgc       300
     ggaacgggct ggcggccgag ctgggcccgg cctcgccgcg gcgcgcgggc gctctgcgcc       360
     gcaactcgct gacgggcgag gagggccagc tggcccgcgt gagcaactgg ccgctctact       420
     gcctgttctg cttcggcacg gagctgggca acgaactctt ctacatcctg ttcttcccct       480
     tctggatctg gaacctggac cctctggtgg gccggaggct cgtggtcatc tgggtgctgg       540
     tcatgtacct gggccagtgc accaaggaca tcatccgctg gccgaggccc gcctcgccgc       600
     ccgtggtcaa gttggaggtc ttctacaact ctgagtacag catgccctcc acccatgcca       660
     tgtccggcac cgccatcccc atttctatgg tcctcctcac ctatggccgc tggcagtacc       720
     ctcttatata tggactgatt cttattccct gctggtgttc tctagtttgc ctaagtagaa       780
     tttacatggg aatgcactct attctggata ttattgctgg attcctatat accattttaa       840
     tcttagctgt cttctatcca tttgtggacc tgattgacaa cttcaaccaa actcacaaat       900
     atgctccatt catcatcatc gggcttcatt tagctttggg gatcttttct ttcactcttg       960
     acacctggag cacatcccga ggagacacag ccgagatact aggaagtggt gctggaattg      1020
     catgtggatc tcatgttact tataacatgg gtctagtatt agatccttct ctagatacat      1080
     tacctttagc tgggcccccc attactgtga ctctgtttgg aaaagccata ttgcggatcc      1140
     tcatagggat ggtatttgta ctaataatca gagatgtaat gaaaaagatc accattcctt      1200
     tagcctgcaa aatcttcaat ataccgtgtg atgatattcg aaaagcaaga cagcacatgg      1260
     aagttgaact tccttatcgg tatattacct atggaatggt tggtttctcc atcacatttt      1320
     ttgttcctta catatttttc tttattggta tctcttgatg gagaagtatt gtttatgata      1380
     agaaaggagg gtatcagtta ctgataccca aaaatatatt ccaggtaaag ccaggtcaga      1440
     attaggcttt tgcaggaatt taacttaaat aattatttaa gtaaattcat aagagtcagt      1500
     gcattttatc attgcacatc cagatactgt tttaggtgag ctgagctatt tcgttactga      1560
     gaaaatgata agtatccatt tagaatgttc atgtaatgtt tggagagttt tgtattatgg      1620
     attccactta tatataatat atataaggta cataatatgc aattatatat ctgatatata      1680
     ttatatataa aataatatac ctaagtgttt ttttaaacta tgggagtgta ttataaaatc      1740
     aataataata tgcaaacagt tgtgcctgtg tatttgaact acatacaggt atgttgttat      1800
     taacagatat atttaacatt tatttactat gggagccatt tcctaattga attgcgtaat      1860
     tactagacca gaatgcatat gctactatac attgatttac tgcctgtttt tacactgcca      1920
     ttacctttca tgttatccat gatgttgaac atgggaggca tttttaatgg accaaatttt      1980
     tagaaaaatt agtttttgga ttttttttta agttctgtat actgttttga atgaacttta      2040
     tttgcagcta ttctggatgt cagtttaata attcaggtac tgaattttat tgcttgctaa      2100
     ttgtgccttt ccgttgctaa attaagaaat gctatgtgta ctgtgatgta aaaataagac      2160
     attaacttta tcttaagtta catataatca agcaaatatt ttaaaaaatg tatgtcaggg      2220
     tgacaggcat aaaagtaaat tacccttaac tctttagc                              2258
//


spacer
spacer