Dbfetch

ID   AJ278119; SV 1; linear; mRNA; STD; MUS; 572 BP.
XX
AC   AJ278119;
XX
DT   22-MAY-2001 (Rel. 67, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for parathyroid hormone-related protein (Pthlh gene)
XX
KW   parathyroid hormone-related protein; Pthlh gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-572
RA   Manenti G.;
RT   ;
RL   Submitted (17-MAY-2000) to the INSDC.
RL   Manenti G., Experimental Oncology, Istituto Nazionale Tumori, Via G.
RL   Venezian 1, 20133, ITALY.
XX
RN   [2]
RX   DOI; 10.1038/sj.onc.1203916.
RX   PUBMED; 11103933.
RA   Manenti G., Peissel B., Gariboldi M., Falvella F.S., Zaffaroni D.,
RA   Allaria B., Pazzaglia S., Rebessi S., Covelli V., Saran A., Dragani T.A.;
RT   "A cancer modifier role for parathyroid hormone-related protein";
RL   Oncogene 19(47):5324-5328(2000).
XX
DR   MD5; d6079a7da0b82869d7d91cbcbf91a4d1.
DR   Ensembl-Gn; ENSMUSG00000048776; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031499; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031474; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031402; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031482; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031203; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031943; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030572; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031163; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031319; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031271; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031405; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031311; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031976; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030298; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030665; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052296; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204197; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0081058; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0081141; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0081070; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0081082; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0080699; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0081559; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0081256; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0080643; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080802; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0080689; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080833; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0080703; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081831; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0080695; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079779; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..572
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /map="73"
FT                   /strain="C3H/HeJ"
FT                   /mol_type="mRNA"
FT                   /tissue_type="Lung"
FT                   /db_xref="taxon:10090"
FT   CDS             22..549
FT                   /gene="Pthlh"
FT                   /product="parathyroid hormone-related protein"
FT                   /db_xref="GOA:Q924X4"
FT                   /db_xref="InterPro:IPR001415"
FT                   /db_xref="InterPro:IPR003626"
FT                   /db_xref="MGI:MGI:97800"
FT                   /db_xref="UniProtKB/TrEMBL:Q924X4"
FT                   /protein_id="CAC39218.1"
FT                   /translation="MLRRLVQQWSVLVFLLSYSVPSRGRSVEGLGRRLKRAVSEHQLLH
FT                   DKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYL
FT                   TQETNKVETYKEQPLKTPGKKKKGKPGKRREQEKKKRRTRSAWPSTAASGLLEDPLPHT
FT                   SRPSLEPSLRTH"
FT   sig_peptide     22..129
FT                   /gene="Pthlh"
FT   mat_peptide     130..546
FT                   /gene="Pthlh"
FT                   /product="parathyroid hormone-related protein"
XX
SQ   Sequence 572 BP; 148 A; 176 C; 156 G; 92 T; 0 other;
     ccagagccag cgagcggcac gatgctgcgg aggctggttc agcagtggag tgtcctggta        60
     ttcctgctca gctactccgt gccctcccgc gggcgttcgg tggaggggct tggccgcagg       120
     ctcaaacgcg ctgtgtctga acatcagcta ctgcatgaca agggcaagtc catccaagac       180
     ttgcgccgcc gtttcttcct ccaccatctg atcgcggaga tccacacagc cgaaatcaga       240
     gctacctcgg aggtgtcccc caactccaaa cctgctccca acaccaaaaa ccaccccgtg       300
     cggtttgggt cagacgatga gggcagatac ctaactcagg aaaccaacaa ggtggagacg       360
     tacaaagaac agccactcaa gacacccggg aagaagaaga aaggcaagcc tgggaaacgc       420
     agagaacagg agaaaaagaa gcgaaggact cggtctgcct ggccaagcac agctgcgagt       480
     ggcctgcttg aggaccccct gccccacacc tccaggccct cgctggagcc cagcttaagg       540
     acgcattgaa attttcatcg aagatcttcc aa                                     572
//