spacer

EBI Dbfetch

ID   AJ276873; SV 1; linear; genomic DNA; STD; HUM; 242 BP.
XX
AC   AJ276873;
XX
DT   22-MAR-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, DR52 variant,
DE   exon 2
XX
KW   HLA-DRB1 gene; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-242
RA   Bengtsson M.;
RT   ;
RL   Submitted (20-MAR-2000) to the INSDC.
RL   Bengtsson M., Dept of Oncology, Radiology and Clinical Immunology, Section
RL   of Clinical Immunology, Rudbeck Laboratory, University Hospital, S-751 85
RL   Uppsala, SWEDEN.
XX
RN   [2]
RA   Bengtsson M.;
RT   "A new DR52 associated DRB1 allele";
RL   Unpublished.
XX
DR   MD5; 0edf286d0c7526c6f29ab9ea171fd43f.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..242
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>242
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /standard_name="MHC class II antigen"
FT                   /product="human leucocyte antigen DRB1"
FT                   /note="DR52 variant"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:45"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="CAB82169.1"
FT                   /translation="LEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTE
FT                   LGRPAAEHWNSQKDILEDERAAVDTYCRHNYGVGE"
FT   exon            1..242
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="DR52 variant"
XX
SQ   Sequence 242 BP; 52 A; 56 C; 89 G; 45 T; 0 other;
     ttggagtact ctacgtctga gtgtcatttc ttcaatggga cggagcgggt gcggttcctg        60
     gacagatact tctataacca agaggagtac gtgcgcttcg acagcgacgt gggggagttc       120
     cgggcggtga cggagctggg gcggcctgct gcggagcact ggaacagcca gaaggacatc       180
     ctggaagacg agcgggccgc ggtggacacc tactgcagac acaactacgg ggttggtgag       240
     ag                                                                      242
//


spacer
spacer