Dbfetch

ID   AJ276492; SV 1; linear; genomic DNA; STD; MUS; 14816 BP.
XX
AC   AJ276492;
XX
DT   17-JUN-2001 (Rel. 68, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Mus musculus FATP4 gene for fatty acid transport protein 4, exons 1-13
XX
KW   FATP4 gene; fatty acid transport protein 4; SLC27A4; solute carrier.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-14816
RA   Herrmann T.;
RT   ;
RL   Submitted (13-MAR-2000) to the INSDC.
RL   Herrmann T., Department of Internal Medicine IV, University Hospital of
RL   Heidelberg, Bergheimer Str. 58, Heidelberg, 69115, GERMANY.
XX
RN   [2]
RX   DOI; 10.1016/S0378-1119(01)00489-9.
RX   PUBMED; 11404000.
RA   Herrmann T., Buchkremer F., Gosch I., Hall A.M., Bernlohr D.A.,
RA   Stremmel W.;
RT   "Mouse fatty acid transport protein 4 (FATP4): characterization of the gene
RT   and functional assessment as a very long chain acyl-CoA synthetase";
RL   Gene 270(1-2):31-40(2001).
XX
DR   MD5; 97aef5e5d5129a06642908442aa6cac9.
DR   Ensembl-Gn; ENSMUSG00000059316; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025544; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025491; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025517; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025279; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025962; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024742; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025256; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025389; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025352; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025475; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025382; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026021; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024488; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024810; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000080065; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053664; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0053678; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0053632; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053621; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053356; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054113; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053522; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0053301; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0053410; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0053372; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0053518; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053357; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054249; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053124; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052633; mus_musculus_wsbeij.
DR   EuropePMC; PMC2173002; 12821645.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..14816
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(<622..694,1894..2060,3349..3743,5089..5247,7398..7467,
FT                   7572..7663,8596..8705,8922..9131,9305..9431,10001..10138,
FT                   10288..10452,10524..10670,13317..14196)
FT                   /gene="FATP4"
FT   exon            <622..694
FT                   /gene="FATP4"
FT                   /number=1
FT   intron          695..1893
FT                   /gene="FATP4"
FT                   /number=1
FT   exon            1894..2060
FT                   /gene="FATP4"
FT                   /number=2
FT   CDS             join(1900..2060,3349..3743,5089..5247,7398..7467,
FT                   7572..7663,8596..8705,8922..9131,9305..9431,10001..10138,
FT                   10288..10452,10524..10670,13317..13474)
FT                   /gene="FATP4"
FT                   /product="fatty acid transport protein 4"
FT                   /note="alternative gene symbol SLC27A4 (solute carrier
FT                   family 27, member 4)"
FT                   /db_xref="GOA:Q91VE0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030304"
FT                   /db_xref="MGI:MGI:1347347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VE0"
FT                   /protein_id="CAC42083.1"
FT                   /translation="MLLGASLVGALLFSKLVLKLPWTQVGFSLLLLYLGSGGWRFIRVF
FT                   IKTVRRDIFGGMVLLKVKTKVRRYLQERKTVPLLFASMVQRHPDKTALIFEGTDTHWTF
FT                   RQLDEYSSSVANFLQARGLASGNVVALFMENRNEFVGLWLGMAKLGVEAALINTNLRRD
FT                   ALRHCLDTSKARALIFGSEMASAICEIHASLEPTLSLFCSGSWEPSTVPVSTEHLDPLL
FT                   EDAPKHLPSHPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGFRMRPDDI
FT                   VYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRY
FT                   LLNQPPREAESRHKVRMALGNGLRQSIWTDFSSRFHIPQVAEFYGATECNCSLGNFDSR
FT                   VGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGQPGQLVGRIIQQDPLR
FT                   RFDGYLNQGANNKKIANDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVS
FT                   TTEVEGTLSRLLHMADVAVYGVEVPGTEGRAGMAAVASPISNCDLESFAQTLKKELPLY
FT                   ARPIFLRFLPELHKTGTFKFQKTELRKEGFDPSVVKDPLFYLDARKGCYVALDQEAYTR
FT                   IQAGEEKL"
FT   intron          2061..3348
FT                   /gene="FATP4"
FT                   /number=2
FT   exon            3349..3743
FT                   /gene="FATP4"
FT                   /number=3
FT   intron          3744..5088
FT                   /gene="FATP4"
FT                   /number=3
FT   exon            5089..5247
FT                   /gene="FATP4"
FT                   /number=4
FT   intron          5248..7397
FT                   /gene="FATP4"
FT                   /number=4
FT   exon            7398..7467
FT                   /gene="FATP4"
FT                   /number=5
FT   intron          7468..7571
FT                   /gene="FATP4"
FT                   /number=5
FT   exon            7572..7663
FT                   /gene="FATP4"
FT                   /number=6
FT   intron          7664..8595
FT                   /gene="FATP4"
FT                   /number=6
FT   exon            8596..8705
FT                   /gene="FATP4"
FT                   /number=7
FT   intron          8706..8921
FT                   /gene="FATP4"
FT                   /number=7
FT   exon            8922..9131
FT                   /gene="FATP4"
FT                   /number=8
FT   intron          9132..9304
FT                   /gene="FATP4"
FT                   /number=8
FT   exon            9305..9431
FT                   /gene="FATP4"
FT                   /number=9
FT   intron          9432..10000
FT                   /gene="FATP4"
FT                   /number=9
FT   exon            10001..10138
FT                   /gene="FATP4"
FT                   /number=10
FT   intron          10139..10287
FT                   /gene="FATP4"
FT                   /number=10
FT   exon            10288..10452
FT                   /gene="FATP4"
FT                   /number=11
FT   intron          10453..10523
FT                   /gene="FATP4"
FT                   /number=11
FT   exon            10524..10670
FT                   /gene="FATP4"
FT                   /number=12
FT   intron          10671..13316
FT                   /gene="FATP4"
FT                   /number=12
FT   exon            13317..14196
FT                   /gene="FATP4"
FT                   /number=13
XX
SQ   Sequence 14816 BP; 3263 A; 3874 C; 4012 G; 3667 T; 0 other;
     gatccctgga gcccatggtg taagaacaga accaactccc acgagttgtc ctctgaccac        60
     acagggtctt tggcatatgt atctacacat acacaaataa gcaaacaaat gtaaataata       120
     ataataagtt aaacaaattc tacttgggcc ttagcttctg gctatgtatt ctcaaatggt       180
     ctgtgggcgg gtttatgcta cctggatccc ctggtccagg aaatggcaga gaggaacgac       240
     ccaaggagca ctgcctgacc agggcaactt cagcagcctg aacaagctag actactagga       300
     ctacaactcc cagcatgccg tgcggctcag cctaccactc ccagcgggcc gggcggctgc       360
     ggaggcagtg gcgcgcgcag ggctggaggg gctgggcggt gtcgggcgcg ctggggctgg       420
     gttgcgctga ggtgcacgga ctcagaagct cgccctctgc ggggacggca cagaaggcgg       480
     tgctgccggc tggcacagcc ggttgcgggt gcgggaggcg ggtgggggtg gagcggggca       540
     gaggtacaga ccctacaagg acgaggagtg ggccagacgc accgaggctc ggctgtgtgt       600
     gccccggggc ggccgatgcc cccagcgcac cgcactccgc tgccgcaacc gggccgcatc       660
     ctgacggggc gccgcgccgc gcagccgcag ccgggtgagc taaggcgggg acggcggctt       720
     tctgagcggg gaaaatgtgc caggccgagc agggggagac ggcggtgccg gctcggactg       780
     aggggcgcgc cctccttctc ccaaccccga gaacgctctg atgtcctggc tatctagagg       840
     caatcggtcc gtggcgcccc tcctgtcctg tctcctctct cagcggtctt gggccggctc       900
     ctagcttgct ttttgactgc ctctgtcaga gagctaagga tcttagcgat cctgcggtag       960
     tcctcccacc cattgcttta tgcttttctc cagaaggcag tctcataagg gattccctgt      1020
     gttccaggcc gtggtcctcc gcctagcttg gagatattca ggctacttca tatctttgac      1080
     cttcctctct tcccaagaaa agcaatccat tagcagtcct cttgactaaa tccataaaga      1140
     agagggaata gagcgtgggc cttaatctct gccctgggct tcaacacagc ctttcccctt      1200
     ctcagcccta gtcctcaaag atccatctga atgtgtgggt acttccaaat ccttttcctg      1260
     tccaacaatc acctctttcc accctacccc tgggctgtca cctctcaggc ccctcctgcc      1320
     tctaagccat ttgctggctc gccctctatg gaccggtaga ggcacaacgc taccttgagt      1380
     ctgtgggcca gagactgtgc agggctccct tcccaggaag ctgccctttt tggtgttgtc      1440
     atttccagaa cctcctggag tccctaggag agacacttct atcagcacct gtctcccggc      1500
     catctggtta ggttgcttga atatcggtga atggactgtc ctgtttgggt tagaaaggtt      1560
     ctaagaacaa gtcttactag cccaatgcat agagcaaggt gctatggcct gaagtaggaa      1620
     aggggctagc acaaggtcac ttgacaaggt ggtcaaagat agaaccagaa gctagatcat      1680
     cctcttgttt cttatcctca gagctgtaga tttcaaggcc cctccaactt ggcatggaac      1740
     caaagccttg aacctttttt aagccacccc ttttaaggtg actaggcaat ccccataggc      1800
     tgaccctttg ggctcatact gaagtggctg ctggtgcaga agtagcggcc cctaaagaag      1860
     gaattgtgtc tcctaaccac cttgtacctg caggtcacaa tgctacttgg agcatctctg      1920
     gtgggggcgc tactgttctc caagctagtg ctgaagctgc cctggaccca ggtgggattc      1980
     tccctgttgc tcctgtactt ggggtctggt ggctggcgtt tcatccgggt cttcatcaag      2040
     acggtcagga gagatatctt gtgagtacca tatctagcct cccttggggt ctcaactgtg      2100
     ctgggcttta ccagccatta tccctgccag cacaagacat ctgggttatt aaaggaacag      2160
     tgtcttctct ttgcccttct cctggcatac ctagaacttt catctccaag gtcaaggtct      2220
     caaggaatct cctaaccccg agactccttg acctggggca caaatcaaag cagatctgtt      2280
     gaaagatgtg tctgagaagg gtcacgagga cactgttcat ggcaaggtga agaagacccc      2340
     agaggaaaag gacctttcct taggttggca cagcctgaaa gagcccaggg ggacactgga      2400
     tgctagcaca aatcctgagt tagacagctg ggagaaattg ctcctagctg ctctatgcta      2460
     ggctggttct gagggtcaga gaggaagaag ctcagacttt taggaggtaa gaaagggacg      2520
     aagtaactcc ctaaactgtc tgtgctattg ctgcagagac cctggtggtc ttgctcactc      2580
     ctgtgttcta gtacccggaa aagggagcct tgcctagaat ggacagctca gtgtttgtca      2640
     gtctgggctg actataagag gtgtctagtg gccccacagg agctgtggga gcatgggata      2700
     aagagagcaa gccccaggtg aggaacttgg gcgggaaacc caagaggtct cctgaaggga      2760
     aaggactctc tgtttgaaag gtgctgtgca ggtgggggag ggggacagag cacagccaga      2820
     ggacccagca ctgacaaaga agtagcagtt ggcagtgtgg gatatggggg tagggtgggg      2880
     gttccacaag ctctggacat tttccctgtg cccagcatgg agaaggccta ggagacaagg      2940
     tagtaaaggt gacaggtacc tgcttccacc tgcagggaga aagctcaccc ctgagcttct      3000
     atggcagtga gggctacggg gagctccgat ctccagatca ggaatggaga ctatgggctt      3060
     ggggccccac cccagagggc ttctagcaga acagcagact tagaagaata agagtagaac      3120
     tctgagccgg gcgtggtggc acacgccttc agtcccagca cttgggaggc agaagcaggc      3180
     aggtctcttg agtttgaaga caactggggc tacacagaaa tcctgtctca gagaaccaaa      3240
     agactaaaag ctagctagct ggttcctgag cctcaggctg tttggacagc agcctgggca      3300
     gtgtcaggag cctggcttag cactgatagc ttctttcctc ccacacagtg gtggcatggt      3360
     gctcctgaag gtgaagacca aggtgcgacg gtaccttcag gagcggaaga cggtgcccct      3420
     gctgtttgct tcaatggtac agcgccaccc ggacaagaca gccctgattt tcgagggcac      3480
     agacactcac tggaccttcc gccagctgga tgagtactcc agtagtgtgg ccaacttcct      3540
     gcaggcccgg ggcctggcct caggcaatgt agttgccctc tttatggaaa accgcaatga      3600
     gtttgtgggt ctgtggctag gcatggccaa gctgggcgtg gaggcggctc tcatcaacac      3660
     caaccttagg cgggatgccc tgcgccactg tcttgacacc tcaaaggcac gagctctcat      3720
     ctttggcagt gagatggcct caggtgagct gcatgtggga gacccgtggg accttgcaca      3780
     gatgacagct ctgttctatt cccgagggag gctgtatgag tctcggcacc agagcttctg      3840
     gacctgccag ggatgctgca gagcctttat gaaccacagg tctcctgagc cttggtttcc      3900
     ctagccgcag caccacagat ctcaagaagg tcttgctctt aagcacccac agagtggcca      3960
     gtgctgtctg gtccttgggt agattggcct cgtctgcttt atctgtacaa ggggagcaga      4020
     acttaggtcc cttccatcct ctcagacctg gcttttattt cttgctgagt cagggatgaa      4080
     aagtgctgag catggagctt tccgaagctc tgatcttcac taagactgaa gagactgcag      4140
     ttgtcatctt ggtttttgga ctgtgagtca ggttcagagg gaagtgaggt gttcacctag      4200
     catcacacag acacagcagg cttacgagtt gatctcaggc tggaccacag acttcctggt      4260
     ctttctccct atactgctgt ggtcatgagg tagtgggaga ggtgttaaga tgctccaagt      4320
     ggagaagaaa gaatacagca gtgagagaag ccctttcggt gagtcagagg gaagccagga      4380
     agactgaaga catagctctt tcattcatag tactgaagaa ggaatttaaa gctaggcaaa      4440
     gcagaaccag caggccagga tcgtctcatg cccagagtga atagagtctc tgccgctcca      4500
     agaggcctga gaaaaggttt tctgcgaatg ggagcctctg tcctcctctt gtcctctaat      4560
     tgtctctgac agaaagccat actagagcag actaaaaaga aaagctcaat gtgagattgc      4620
     agcatctctt ccatctttag cattactttc accatctgta aaatgggctg atggtagcta      4680
     gcatgatggt atataccaaa aatcctagca ctaggggcca ggaggattgg gttacattgc      4740
     attacatcgc attatcaggc catatacata gctactttcc ctccttctcc tcctctccct      4800
     cttcttcttc ctcctcttct ttccgttctt tttttcagca gggtcagagg tcagggaggt      4860
     ggagaattgg tttttggtag ctacctccca actctgagca ggagcctatg agtaaggcat      4920
     cgtgattcct gaaagttcct gagaaatgca tctcctgaca atagtaaatg tgtctcaccc      4980
     atttccccac accattcagt cttccctgac tgtcagccat gcatgacaaa ggtccaggga      5040
     acacgggctt gctagactgc ctgctgacct gaagtgtctc gtcttcagct atctgtgaga      5100
     tccatgctag cctggagccc acactcagcc tcttctgctc tggatcctgg gagcccagca      5160
     cagtgcccgt cagcacagag catctggacc ctcttctgga agatgccccg aagcacctgc      5220
     ccagtcaccc agacaagggt tttacaggtg ggccttacaa tacatggaga gttccaaaat      5280
     gttctagaag acagtgctgg cctcagggct gcagacttgt cagtcatgtg ccttgaacag      5340
     gttgaggcac ctcccctttt ccatctggaa aatggggcgg gattactagt aaggtgaaat      5400
     tgtcgatttg tggagcaacc catggtcaca ccttgtatgt aggattgtgt gtaccctgca      5460
     gcttgccagg tggagaggag ggtaagtgtg agaccctcag tgtagccttc cagcttgttg      5520
     agtgtaggcc ctgccaggcc ccagcctttg ccctctcctc caggaagcct ccctggagtg      5580
     tcttctctac actggagccc gacagccctt cagctgctgc tctttctact cttccctgaa      5640
     gtctcaccac ctgctttgtt gcctgctgcc tgctgagccc ccccccaccc ccatctgagt      5700
     tctgttctgg ctctgctact tccctgcctc tgacctgccc tctgacctgc cctctgagcc      5760
     tcaggtcctg ctgcaataaa gttggggata gtagcaatct actttatggg cttattgtaa      5820
     aggtcaaccc ggaggctagg gtatcagcag gaagggctgg gacttgtcat tgccagaatt      5880
     gagactctcc tttccctcat ttcttagatg cttccagaag ctgcttgacg gcagggaccg      5940
     tgactggttc cccgtcttac tctcaactac ccaggactgg cacacagcag gtgccacagt      6000
     gcctgaggtg gctgctggca gtgccgtccg gcggggttct tgacctcctg agaaacacac      6060
     ccctgtgtca gggtgtgaca gggtacttgg tgacagtacc catttgagtg ggcagatgga      6120
     catcagtggt gtggagtggc catagtgcct gcttctttta ttcttttttc ctgctttttg      6180
     agacagggtt tctttacata gccttggctg tcctgaaact cacttatgta caccaggctg      6240
     gccttgaact cagatccatg cctctgctgg gattctcctg agtgctgcag tttaaggcca      6300
     gcatgcttaa cctttgtttt tgtttttttt ttttgttggt ttttgggttt tttggtttgg      6360
     tttggtttgg tttggttttt cgagacaggg tttctctgta tagccctgct ggctgtcctg      6420
     gaactcactt tgtagaccag gctggccttg aactcagaaa tccgcctgcc tctgcctccc      6480
     aagtgctggg attaaaggcg tatgccacca ccgcccagct tttttttttt tttttttatc      6540
     ttttgagatt gtgtcttttt tttgtttttg tttttgtttt ttgttttttg tttttcgaga      6600
     cagggtttct ctgtgtagct ctggctatcc tggaactcac tctgtagacc aggctggcct      6660
     cgaactcaga aatctgcctg cctctgcctc ccaagtgcta ggattaaagg cgtgcaccac      6720
     caccgcccgg cttttttttt ttttttttaa agattcattt attttattta tatgagtaaa      6780
     ctgtagctgt ctttgttgtg agtcaccctg tggttgctgg aaattgaact caggaccttt      6840
     ggaagagcca tcagtgctct taaacgctga gccatctctc caggcctgag atggtgtctt      6900
     tctacgtagt tctcactgtc cttttagctc agtgtgtctc aatctcacag agatcttcct      6960
     gtctctgcct cctaagcact agattaaagt tatacaccac ctcattaccc ttgtaactaa      7020
     gccttgaagc aggtatccac ttctataaac cctcctgata ccacctttgc acctgtcagc      7080
     tgagccagct ggtgcttagc tgtcaccagt cctatgtccc cacgacgagg cttggtgttg      7140
     aagtgttttg tcttcgtctg attgtctcac tcagctggga cttcagagag gaccagctct      7200
     gtattcatct cagccactgc tctttcactc aacctgtccc tgggtgagcc tgggagggag      7260
     gtgctgttga ggtcgtcagt aggtctgtct cctggaagag atgtagaaat gggctgaagg      7320
     gcatgcgcct tctgtctccc cacacggtcc tgcggccgct ctcctagtaa cctgcattgc      7380
     atatctgttt tcttcagata agctcttcta catctacaca tcgggcacca cggggctacc      7440
     caaagctgcc attgtggtgc acagcaggta atggacaagg gcccagggct ggatgtggcc      7500
     tgtatgggac tgggaagcgt cctcttgcca tccccgggtc ccactgacct ctttgccctg      7560
     tccccttgaa ggtattatcg tatggcttcc ctggtgtact atggattccg catgcggcct      7620
     gatgacattg tctatgactg cctccccctc taccactcag caggtaaccc tgggcctgcc      7680
     cttagctgcc agcaccctgt gcctttagaa ggcccacttt cctagccact tataatagaa      7740
     gcatggggcg gggccatcta ctccaccaca gtcttcttgt tcactgatga tgacatgagg      7800
     ttcctgtgtc tcagggggca tcgtgcctgc tgtgcagtga ggttggtttc tacagatgtg      7860
     cagcatctca ctgctccgtt acagagcata agggaggaaa gcttgagtat cagcctgacc      7920
     tctggggcag ggttatggcc gctccacacc acagagctgg tccatgttgg gaacctgcct      7980
     gacactcagg aagagaaggt aggaagggac acagtgagga agcacaagtg tcaccctcaa      8040
     gaagacctgt ggtgggggct gagacctcct agaggaaaca taccagttag gagagcagtc      8100
     ctgagtggcg actgtgcaga caagaagcgt gtgcttagtc gggtgtggtg gctcacgcct      8160
     ttaatcccag cacttgggag gcagaggcag gtggatttct gagttcgagg ccagcctggt      8220
     ctacagagtg aattccagga cagtcagggc tacacagaga aaccctgtct cgaagaaaaa      8280
     aaaaaaaaaa agtgtgtgct tgatcccaca ggtactggaa acatggtaga tagggaagag      8340
     gtgtggccag ttagcaggac agaacaggag gaggagacca agggaaggcc tgtgaagaga      8400
     cagggctgga agctggttgt ggtagtgaac ccttataata tagcacttgg aaagtggagg      8460
     cctatcttct actacacagc aagtttgagg ctagcctgga ctatttgaga ccctgtctca      8520
     gaagaggcag gtctgaatga gattaggctc tggggtgggg tcactgtcct gacctccagg      8580
     cccctctgac ttcaggaaac atcgtgggga ttggccagtg cttactccac ggcatgactg      8640
     tggtgatccg gaagaagttc tcagcctccc ggttctggga tgattgtatc aagtacaact      8700
     gcacagtgag tgagaaggga caggcatgag cagccccatc cccatgtccc cccccccctt      8760
     gccacccata cactggggca tctgagcagc tgagacttca gaatgctccc ttgggcagcg      8820
     tcttcattgc tcggatgaga gggaagggac tgtcgggcca ctgtggggag gtgacgaagt      8880
     gggcacccct agagtctgga ctgacaccac acccacccca gattgtacag tacattggcg      8940
     agctctgccg ctacctcctg aaccagccac cccgtgaggc tgagtctcgg cacaaggtgc      9000
     gcatggcact gggcaacggt ctccggcagt ccatctggac cgacttctcc agccgtttcc      9060
     acatccccca ggtggctgag ttctatgggg ccactgaatg caactgtagc ctgggcaact      9120
     ttgacagccg ggtaaggtcc agattggggc tagtagggct gctgtggggg gtggatcaca      9180
     ataggcccta ggcttgcaga gggggaagca gaataccagc atgggagtgg ataccagagt      9240
     ctctccagcc cctctgtctg tttgggagtc catggagccc tggcctaaat ctcggccttt      9300
     gcaggtgggg gcctgtggct tcaatagccg catcctgtcc tttgtgtacc ctatccgttt      9360
     ggtacgtgtc aatgaggata ccatggaact gatccgggga cccgatggag tctgcattcc      9420
     ctgtcaacca ggtctgccca ggagggaatg gacatttgtg ggggaaggtg ttgtcttgga      9480
     ggatagtcag tgtggataaa ccattctgag tgtgggttct gctttaccca ctgctcaccc      9540
     cactgtcgtc accaaccctt gctcactcgc tcgctcgccc gccgtgccat ctgcacacct      9600
     ccctgagaag gctccatcct ggcctcatac acgagcccct catcttcatg cagagctgat      9660
     ggcagtgcct ggttcagggt gtgtgtggta aagtgtgagg cactcactga ggagagcctg      9720
     gacaggtgta gggctcagtg gtaccaggtt gctcggctgt ctagtcgggc ctgtgtatgc      9780
     tcgctggtct ttcctggatt gattcattgg gtcctcactg ttggtggccc attccgtgct      9840
     ccaaaactgc tcagatgtgc tccctgatct cagccacctt ctgtccagga gacaaatggg      9900
     gcatttctgt aatagcatta agtcagcata agatgcaggg tgcctttgtg gatggagaca      9960
     ggtagacgag gccacacctg actggcttcc tcgtccctag gtcagccagg ccagctggtg     10020
     ggtcgcatca tccagcagga ccctctgcgc cgtttcgacg ggtacctcaa ccagggtgcc     10080
     aacaacaaga agattgctaa tgatgtcttc aagaaggggg accaagccta cctcactggt     10140
     gagtcccctg ctgtttgtcc ttccagaggg gacagggaga aatgagagct tccagtctca     10200
     gagaacacat cccctgtgat gacttcctga ctcaacctgt gtcaggaact aggctggccc     10260
     agtcatgact aactgtcccc tccctaggtg acgtcctggt gatggatgag ctgggttacc     10320
     tgtacttccg agatcgcact ggggacacgt tccgctggaa aggggagaat gtgtctacca     10380
     ctgaggtgga gggcacactc agccgcctgc ttcatatggc agatgtggca gtttatggtg     10440
     ttgaggtgcc aggtatgtga ggggaggatg gtgagcatgt ccgaacattg cctgccactg     10500
     actgtgtacc ctcctgcttc caggaactga aggccgagca ggaatggctg ccgttgcaag     10560
     tcccatcagc aactgtgacc tggagagctt tgcacagacc ttgaaaaagg agctgcctct     10620
     gtatgcccgc cccatcttcc tgcgcttctt gcctgagctg cacaagacag gtctgtccct     10680
     ggttccagct cctggctttc agggctgggt ctttctgtag tataaactcc ctggctaatc     10740
     tcttaccttg acaaacagcc ttgcccgtag gctgagatac tgctctcctg ggtggaaatg     10800
     tgcaaaccca gcttcagaga aggctcacca tctcttagaa tgggggacta ttctatggct     10860
     gccatactat ggtttagacc cagagtagaa aaattccaga ggtatggaat gggctgggtg     10920
     tggtaacacc cctgtaatcc tgatgcttca gaatggagga aagaggccag ccttggcgtt     10980
     acaacacaca agaccctgtc ttagcaacaa caaagcagca agaaagaaaa tggacttcag     11040
     atcatggcac aatagactag gacagaactc agtggacgag cttgtctaat gtacatgaat     11100
     ccttaggttc attcccagta gcacagaaaa atagtaataa gtgggtgagt gagtaagtaa     11160
     ataataaggc atataggcaa atagtattag accaataaat taaaaggaaa aaagaccccc     11220
     gaacctggat gcttcaacag tagtgtgctg tgggccatca gcagaggcca tcaggaccct     11280
     tataggccta taggatctta tagaccaggg tggaagtggg atggcctaga aattagtagg     11340
     aagttatcta aatgtaagat tggtcccaca gagatctcca gcttcagggt agagagtggc     11400
     agagaactat agatgtctca caaggagtta gtatccaaga gtgagctgtg ggtgggtcta     11460
     tgatcacata gagtcttagt cagggtttct gtttctgcac aaacatcatg accaagaagc     11520
     aagttgggga ggaaagggtt tattcagctt acacttccac atttgctgtt catcaacaac     11580
     agaagtcagg actggaactc aggcaagtca ggaagcagga gctgatgcag aggccatgga     11640
     gggatgttct ttactggctt gtttccctgg cttgctcagc ctgctctctt atagaaccca     11700
     agactaccag cccagagatg gcaccaccca caaggggccc ttcccacctt gatcactaat     11760
     tgagaaaatg ccttacagct ggatggaggc atttcctcaa ctgaagctcc tttctctgtg     11820
     ataactccag ctgtgtcaag ttgacacaga accagccagt acacatagta gcacagtgac     11880
     atccttctgt agtggtctac tgatggcttt caggagttcc ctgagtcagg aaggggatgt     11940
     ggaatctcct gttaggccca ccatactgtc cttagggtcc ttcctgcctc tctccattgc     12000
     tcaggctcat ccctagctgc ttacccaggg gtccatgtgc ctgaccccct cccatgcatt     12060
     gtcagttcca agccttctct ggctgctgag gtctgtcagc ttgtggacat ctgtacccca     12120
     tgcaacatat gagacggtgg gaggggccta ggctgcagtg tgacataggg agggacacag     12180
     ggcagtctca taactgagga gactgaactt cctgaggatt ggaagtgtga ccctgtccag     12240
     gacaagcaag acagcttttc tgcagagtga actacatgca aggatgtctg aggatcacag     12300
     ttctgtaggt tagtgatgtg gggtttaaat tcaactgtaa ggtgttagtg gggctgcaga     12360
     ggccatagtt gctctcttct gcagccccat ccaacaaaac tttgtgtgct ggtaggagtg     12420
     tttggcatct ctactgccta ctatggtggc agctagtacc atggagggat tgggcattta     12480
     agatggagtt ggtgtgcctg aggaactggc acatgggcag tgctggtcta gggggctggt     12540
     ctgggttggt ttgtatcttt catctgcttc tcaatcttcc aaggctgggc tgtcctcagg     12600
     gatttctccc cgccagcccc aaggctgggc tggcctcagg gttctctccc tgccaccccc     12660
     aaggctgggc tggtctcagg gttctctccc cactgccccc aagagcgtgg gttggaatgg     12720
     cagggtcctt ggaagcctag actcactgga attccagagc agtgcttcag agcaagctag     12780
     aaggccagtc tggtttggag tttctggaat tgtggtttct gttgggagca ataggtagca     12840
     tttcagaggc tagcagatct agggagaggg tctgtcattc ctgtgttcaa atcctggtta     12900
     ccacttattt cctgtgtgac tttgctttct ccccccaaaa tggcatggtg atgtacccct     12960
     ttaatcccag cactgtagat ctagagacca gtggatcgct aagagtttga aggacagcca     13020
     gggctatcta gtgagaccct gtccataaaa agggggaaat ggagaagaaa atacatgcat     13080
     cttagaatat gactgagcct caagacgttg aggcctctgt gtccagtcag tactcaaata     13140
     aaagggacca gattctggcc tctactctgc tgcccatcag agatgtcgtt ggacatacac     13200
     agtgtcccca tgtcctttct cccctcccta gctctccctt tctcaacccg tcatcagatt     13260
     tgtaggagct ccaacccctg ccttgcactt tctgactttt cttacccact ctctagggac     13320
     cttcaagttc cagaagacag agttgcggaa ggagggcttt gacccatctg ttgtgaaaga     13380
     cccgctgttc tatctggatg ctcggaaggg ctgctacgtt gcactggacc aggaggccta     13440
     tacccgcatc caggcaggcg aggagaagct gtgatttccc cctacatccc tctgagggcc     13500
     agaagatgct ggattcagag ccctagcgtc caccccagag gggtcctggg caatgccaga     13560
     ccaaagctag cagggcccgc acctccgccc ctaggtgctg atctcccctc tcccaaactg     13620
     ccaagtgact cactgccgct tccccgaccc tccagaggct ttctgtgaaa gtctcatcca     13680
     agctgtgtct tctggtccag gcgtggcccc tggccccagg gtttctgata ggctccttta     13740
     ggatggtatc ttgggtccag cgggccaggg tgtgggagag gagtcactaa gatccctcca     13800
     atcagaaggg agcttacaaa ggaaccaagg caaagcctgt agactcagga agctaagtgg     13860
     ccagaaacta tagtggccag tcatcccatg tccacagagg atcttggtcc agagctgcca     13920
     aagtgtcacc tctccctgcc tgcacctctg aggaaaagag aacagcatgt ggccactggg     13980
     cacctgtctc aagaagtcag gatcacacac tcagtccttg tttctccagg ttcccttgtt     14040
     cttgtctcgg ggagggaggg acgagtgtcc tgtctgtcct tcctgcctgt ctgtgagtct     14100
     gtgttgcttc tccatctgtc ctagcctgag tgtgggtgga acaggcatga ggagagtgtg     14160
     gctcaggggc caataaactc tgccttgact cctcttagcc tgacagcctg gctccttgcc     14220
     tacctccttc ccctctagcc cctttcgctt agcccttggg ataagccctt agccagtcct     14280
     cttttccaaa gctctgcctt cctataactc cttaggagag actcccacca gatctgacag     14340
     gatgttaaac tttggaactt aacctttaaa ataagcatgt ggctttgggc aagtgtctcc     14400
     tgaattatgg gggtaattaa gggattcaga aactacacaa agccattagg agtgggagga     14460
     tacttggcgt ctttgaggga aagccctccc ctgcacagaa ctgtccatgg acccatgcgc     14520
     tgttgctcca tcttctgcca aatgacccat tggagcctcc ccagccctct gaggctttct     14580
     atgaaagttt catgtctaag ctctgtcttc ttggccagga ggcctctgca cccgggctga     14640
     gactgacagg cacctttagg atgatgcatc tgatccagac agactgcctg acctcctcag     14700
     gcaaccctag ccagtcagca gcacattggt ccagagtcct ccagcctggg agtccctggg     14760
     aagtacagag ggtcctaaca gcccagggtg gactgctcaa gggccctcct ccactg         14816
//